(data stored in ACNUC7421 zone)

EMBL: CP002355.PE211

CP002355.PE211       Location/Qualifiers
FT   CDS             203145..203786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0212"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="COGs: COG0790 FOG: TPR repeat SEL1 subfamily;
FT                   InterPro IPR006597; KEGG: ara:Arad_2749 hypothetical
FT                   protein; PFAM: Sel1 domain protein repeat-containing
FT                   protein; SMART: Sel1 domain protein repeat-containing
FT                   protein; SPTR: Putative uncharacterized protein; PFAM: Sel1
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32879"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW6"
FT                   /protein_id="ADR32879.1"
FT                   /translation="MKKYLYLLFFLVTPLFSSEGQQSFWETYTDALRGNKEAQFQVGVI
FT                   FERGIGREENQSLAAQWFEKSAEQGHVDAQYNVAIMYAAGRGVDVDEGKAMMWLAKAAK
FT                   QKDKEARKLLNDIIDGKLDKKSSDAVNNYHDAVSDNSFEMITPTTLMTKEGAKVCDQKG
FT                   ICIALKANTALTSTSKNRQFYKISGTVTKKGWQEYKKEGWIDENSVEIRR"
     MKKYLYLLFF LVTPLFSSEG QQSFWETYTD ALRGNKEAQF QVGVIFERGI GREENQSLAA        60
     QWFEKSAEQG HVDAQYNVAI MYAAGRGVDV DEGKAMMWLA KAAKQKDKEA RKLLNDIIDG       120
     KLDKKSSDAV NNYHDAVSDN SFEMITPTTL MTKEGAKVCD QKGICIALKA NTALTSTSKN       180
     RQFYKISGTV TKKGWQEYKK EGWIDENSVE IRR                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page