(data stored in ACNUC7421 zone)

EMBL: CP002355.PE213

CP002355.PE213       Location/Qualifiers
FT   CDS             complement(204142..204357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0214"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ant:Arnit_1835 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32881"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW8"
FT                   /protein_id="ADR32881.1"
FT                   /translation="MGYRPRKSPFTHLKARNLVYTENDQTYTLISFNRDSMLLEVHIKD
FT                   GTETKIVTDFPFAHLPKKIKQELNPL"
     MGYRPRKSPF THLKARNLVY TENDQTYTLI SFNRDSMLLE VHIKDGTETK IVTDFPFAHL        60
     PKKIKQELNP L                                                             71
//

If you have problems or comments...

PBIL Back to PBIL home page