(data stored in ACNUC7421 zone)

EMBL: CP002355.PE214

CP002355.PE214       Location/Qualifiers
FT   CDS             complement(204347..205186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0215"
FT                   /product="hypothetical protein"
FT                   /note="COGs: COG2996 conserved hypothetical protein;
FT                   InterPro IPR014464; KEGG: tdn:Suden_0312 hypothetical
FT                   protein; SPTR: Nucleic acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32882"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXW9"
FT                   /protein_id="ADR32882.1"
FT                   /translation="MNETLKVGEINILVIDRSTVPGLFLRALDESDILLPNQYVTESMH
FT                   IGDTIDVFVYTDSEDRPVATTVKPKAMVNEIAFVEVVDTNSIGAFVDWGLPKDLFVPRA
FT                   LQKRPFAVGEKRLVRVILDDQTNRLVGTEKISGALETPPKSFYPNTPVEFMIIAKTPMG
FT                   YKVIVDHKYEGMIYANEIFEDVRVGQIKKGFVKLLRPDGKLDLSLQMVGKAKASSAADK
FT                   IFSMIQGNGGMLPYNYKSDPDLIQKTFGLSKKNFKAALTQLVDAKKITVQENGIYGI"
     MNETLKVGEI NILVIDRSTV PGLFLRALDE SDILLPNQYV TESMHIGDTI DVFVYTDSED        60
     RPVATTVKPK AMVNEIAFVE VVDTNSIGAF VDWGLPKDLF VPRALQKRPF AVGEKRLVRV       120
     ILDDQTNRLV GTEKISGALE TPPKSFYPNT PVEFMIIAKT PMGYKVIVDH KYEGMIYANE       180
     IFEDVRVGQI KKGFVKLLRP DGKLDLSLQM VGKAKASSAA DKIFSMIQGN GGMLPYNYKS       240
     DPDLIQKTFG LSKKNFKAAL TQLVDAKKIT VQENGIYGI                              279
//

If you have problems or comments...

PBIL Back to PBIL home page