(data stored in ACNUC7421 zone)

EMBL: CP002355.PE215

CP002355.PE215       Location/Qualifiers
FT   CDS             205227..205979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0216"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="COGs: COG0300 Short-chain dehydrogenase of various
FT                   substrate specificities; InterPro IPR020904: IPR002347:
FT                   IPR002198; KEGG: tdn:Suden_1903 short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; SPTR: Short-chain
FT                   dehydrogenase/reductase SDR; PFAM: short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32883"
FT                   /db_xref="GOA:E4TXX0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX0"
FT                   /protein_id="ADR32883.1"
FT                   /translation="MRILITGASSGLGEVLALHYATKDNTLVLIARREDRLSDVASRCR
FT                   ELGADVETLVADVNDFERIREIGTELGQNPIDRIILNAGVSVGHNGGVTPFEDFERLFK
FT                   TNFLSIHALLEPIIPKLMEQRSGEIVFISSLASLLSMPTSIAYSSSKRALNAYAEGLHY
FT                   QLKPHGISVMTIMPGFIDSEMTRKNRFKMPFLLKTEEGVARIVRAIERKKIRYAFPFRF
FT                   YLMIRIVLLFPQSLRDKIVNFTNFKKGQ"
     MRILITGASS GLGEVLALHY ATKDNTLVLI ARREDRLSDV ASRCRELGAD VETLVADVND        60
     FERIREIGTE LGQNPIDRII LNAGVSVGHN GGVTPFEDFE RLFKTNFLSI HALLEPIIPK       120
     LMEQRSGEIV FISSLASLLS MPTSIAYSSS KRALNAYAEG LHYQLKPHGI SVMTIMPGFI       180
     DSEMTRKNRF KMPFLLKTEE GVARIVRAIE RKKIRYAFPF RFYLMIRIVL LFPQSLRDKI       240
     VNFTNFKKGQ                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page