(data stored in ACNUC7421 zone)

EMBL: CP002355.PE216

CP002355.PE216       Location/Qualifiers
FT   CDS             206005..208080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0217"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="COGs: COG3383 Uncharacterized anaerobic
FT                   dehydrogenase; InterPro IPR006655: IPR006963: IPR006656:
FT                   IPR006657; KEGG: nis:NIS_1552 formate dehydrogenase, alpha
FT                   subunit; PFAM: molybdopterin oxidoreductase; molybdopterin
FT                   oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region; SPTR: Formate dehydrogenase,
FT                   alpha subunit; PFAM: Molybdopterin oxidoreductase;
FT                   Molydopterin dinucleotide binding domain; Molybdopterin
FT                   oxidoreductase Fe4S4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32884"
FT                   /db_xref="GOA:E4TXX1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX1"
FT                   /protein_id="ADR32884.1"
FT                   /translation="MTIDSVCTYCGVGCDISAEVEDNKIQKIFAKDEGVVSQGRLCIKG
FT                   KQGWDFLTHPKRLRNARVRKTFLAKNSALFADFDMDYLEPVDHDFYEISYESAYELAAR
FT                   KLKSITDEHGSHSFAAIGGARTSCESSYLFQHFTRHVVGSPHVDNCARVCHSPSLKGMR
FT                   TTIGEGAMSNPFDDIYETEFMVVMGSNTTEGHPIVANRMLDVIKNNGVELAVLDVRRIQ
FT                   LSKSATHHLSIPYEANLMILNMLAYVIISENLVNVEFVNSRTKGYEAYKSSILNDSYAN
FT                   PEFLLQIPGYESLVDDIRIVARKYATRKSLFFWGLGITEHLDGSYAVMAITHLAMLTGN
FT                   IGKRGAGLMPLRGQNNVQGTCDVGMLPYYAPDYQPPKEVGMMTPDLINAMCDGKIKALF
FT                   NISEDIAHIHPNQNKIHAALGNLDLLVVNELFDNEVTKFADIIFGVKSAYEKTGVYVNA
FT                   ERRLHLSQPLVRATMPDDWEVIAEISKRYGVDLGVASSYDVWEKVRADAPNRFGGASYE
FT                   KLEANRLRGLQWPVQEEDLPVLHIGTFRTKDGLGSFHYHQYSPRGQVEELLNVKSHEGY
FT                   YLTTGRILVHYNNGAQTNACDKLSRSHSEDTLLVSVEDEDFFEYKDFVVLKSEYGQSAP
FT                   LRVKVSSTVKKGTLFTTFHHAKSNINFLFGDECDELIKTARFKSIKVEVIKPDYLD"
     MTIDSVCTYC GVGCDISAEV EDNKIQKIFA KDEGVVSQGR LCIKGKQGWD FLTHPKRLRN        60
     ARVRKTFLAK NSALFADFDM DYLEPVDHDF YEISYESAYE LAARKLKSIT DEHGSHSFAA       120
     IGGARTSCES SYLFQHFTRH VVGSPHVDNC ARVCHSPSLK GMRTTIGEGA MSNPFDDIYE       180
     TEFMVVMGSN TTEGHPIVAN RMLDVIKNNG VELAVLDVRR IQLSKSATHH LSIPYEANLM       240
     ILNMLAYVII SENLVNVEFV NSRTKGYEAY KSSILNDSYA NPEFLLQIPG YESLVDDIRI       300
     VARKYATRKS LFFWGLGITE HLDGSYAVMA ITHLAMLTGN IGKRGAGLMP LRGQNNVQGT       360
     CDVGMLPYYA PDYQPPKEVG MMTPDLINAM CDGKIKALFN ISEDIAHIHP NQNKIHAALG       420
     NLDLLVVNEL FDNEVTKFAD IIFGVKSAYE KTGVYVNAER RLHLSQPLVR ATMPDDWEVI       480
     AEISKRYGVD LGVASSYDVW EKVRADAPNR FGGASYEKLE ANRLRGLQWP VQEEDLPVLH       540
     IGTFRTKDGL GSFHYHQYSP RGQVEELLNV KSHEGYYLTT GRILVHYNNG AQTNACDKLS       600
     RSHSEDTLLV SVEDEDFFEY KDFVVLKSEY GQSAPLRVKV SSTVKKGTLF TTFHHAKSNI       660
     NFLFGDECDE LIKTARFKSI KVEVIKPDYL D                                      691
//

If you have problems or comments...

PBIL Back to PBIL home page