(data stored in ACNUC7421 zone)

EMBL: CP002355.PE217

CP002355.PE217       Location/Qualifiers
FT   CDS             208086..208421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0218"
FT                   /product="Uncharacterized protein family UPF0102"
FT                   /note="COGs: COG0792 endonuclease distantly related to
FT                   Holliday junction resolvase; InterPro IPR003509; KEGG:
FT                   ant:Arnit_2816 hypothetical protein; PFAM: Uncharacterised
FT                   protein family UPF0102; SPTR: UPF0102 protein Arnit_2816;
FT                   PFAM: Uncharacterised protein family UPF0102"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32885"
FT                   /db_xref="GOA:E4TXX2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX2"
FT                   /protein_id="ADR32885.1"
FT                   /translation="MHTRARGNLAEERGCDYLRGKGLRIIDRNVYNRFGEIDIIALSSD
FT                   NVLHFIEVKSGSSYEQAVNNITSSKLQKLNRTIQTYLQQKKLNLDYCIDALIISDETLE
FT                   WIENITL"
     MHTRARGNLA EERGCDYLRG KGLRIIDRNV YNRFGEIDII ALSSDNVLHF IEVKSGSSYE        60
     QAVNNITSSK LQKLNRTIQT YLQQKKLNLD YCIDALIISD ETLEWIENIT L                111
//

If you have problems or comments...

PBIL Back to PBIL home page