(data stored in ACNUC7421 zone)

EMBL: CP002355.PE218

CP002355.PE218       Location/Qualifiers
FT   CDS             complement(208418..210466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0219"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="COGs: COG2200 FOG: EAL domain; InterPro IPR000160:
FT                   IPR001633; KEGG: nam:NAMH_0258 diguanylate
FT                   cyclase/phosphodiesterase; PFAM: EAL domain protein; GGDEF
FT                   domain containing protein; SMART: EAL domain protein; GGDEF
FT                   domain containing protein; SPTR: Diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PFAM: EAL domain; GGDEF domain; TIGRFAM: diguanylate
FT                   cyclase (GGDEF) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32886"
FT                   /db_xref="GOA:E4TXX3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX3"
FT                   /protein_id="ADR32886.1"
FT                   /translation="MKLSHKLALTAVLGGSALISLFLFKTFSHDYFTDRNKLGLNFKAI
FT                   ETAQNQLDNQILNNAFFLYTNQDGINDKINHVHKELDILLRNPHIIQEHPNTYAALQKY
FT                   RAQFNHKVNAIYDFQTTNIVIKNTTAALLASQQHLFEHDETTPQGQEVLYEINRLAGSI
FT                   LLAKNALDSELITSLRPKIAALEHYRFVNPKNEELTQRMISHFKVIEQYFPQFVKVTEQ
FT                   IKDPALSATLSEAETAFYRESDAELRFVSYFSYLLVTLFIISIGIIAIFLVQSEREARI
FT                   DPLTRLRNRKAYEEDLKRKGEKAALILININKFKHYNDFYGVKEGDRLLIETAHHIQNI
FT                   PFAGYNPSYYRLGADDFGILFELFDYNDLHAISKTFLKTFSERPILIDNEPRTPSISIS
FT                   ASKFSPLLETADMALKNKTHTNPTVYHQGLNLHQIIADNVTKARELKDALAENRIVPYF
FT                   QPIISLSTRSVTKHEVLARIIMKDDQARSIYPYLHIAKESNLYPQLTRAIVTQSFAIIA
FT                   EHEGDFSINVSIDDIGNKETVALLEQLLEQYESIGKRIIFELLESEAIEEYNEIVEFIV
FT                   KMRRYGCRIAIDDFGSGYSNFSRILNLAIDIIKIDGSLIRNLDTDDKAITIVQTIVNFT
FT                   KNSSIKTVAEFVHNEAIADIVEKLEIDSAQGFYFYEPARHPVTVGQP"
     MKLSHKLALT AVLGGSALIS LFLFKTFSHD YFTDRNKLGL NFKAIETAQN QLDNQILNNA        60
     FFLYTNQDGI NDKINHVHKE LDILLRNPHI IQEHPNTYAA LQKYRAQFNH KVNAIYDFQT       120
     TNIVIKNTTA ALLASQQHLF EHDETTPQGQ EVLYEINRLA GSILLAKNAL DSELITSLRP       180
     KIAALEHYRF VNPKNEELTQ RMISHFKVIE QYFPQFVKVT EQIKDPALSA TLSEAETAFY       240
     RESDAELRFV SYFSYLLVTL FIISIGIIAI FLVQSEREAR IDPLTRLRNR KAYEEDLKRK       300
     GEKAALILIN INKFKHYNDF YGVKEGDRLL IETAHHIQNI PFAGYNPSYY RLGADDFGIL       360
     FELFDYNDLH AISKTFLKTF SERPILIDNE PRTPSISISA SKFSPLLETA DMALKNKTHT       420
     NPTVYHQGLN LHQIIADNVT KARELKDALA ENRIVPYFQP IISLSTRSVT KHEVLARIIM       480
     KDDQARSIYP YLHIAKESNL YPQLTRAIVT QSFAIIAEHE GDFSINVSID DIGNKETVAL       540
     LEQLLEQYES IGKRIIFELL ESEAIEEYNE IVEFIVKMRR YGCRIAIDDF GSGYSNFSRI       600
     LNLAIDIIKI DGSLIRNLDT DDKAITIVQT IVNFTKNSSI KTVAEFVHNE AIADIVEKLE       660
     IDSAQGFYFY EPARHPVTVG QP                                                682
//

If you have problems or comments...

PBIL Back to PBIL home page