(data stored in ACNUC7421 zone)

EMBL: CP002355.PE22

CP002355.PE22        Location/Qualifiers
FT   CDS             complement(24657..25079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ant:Arnit_1851 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32690"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW74"
FT                   /protein_id="ADR32690.1"
FT                   /translation="MSYKQWFDAHAAKHAAIMEKLTRLSDDEVIEYFRFENMVKNEPDF
FT                   CPLYAENKKCHDTEELNCYLCACPNFRFSDAGFAVEERKILFSTCSIESPDGDRYVSES
FT                   AIHQNCAGCIVPHRESYIKKVFDRDWLKIMKEVPSE"
     MSYKQWFDAH AAKHAAIMEK LTRLSDDEVI EYFRFENMVK NEPDFCPLYA ENKKCHDTEE        60
     LNCYLCACPN FRFSDAGFAV EERKILFSTC SIESPDGDRY VSESAIHQNC AGCIVPHRES       120
     YIKKVFDRDW LKIMKEVPSE                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page