(data stored in ACNUC7421 zone)

EMBL: CP002355.PE220

CP002355.PE220       Location/Qualifiers
FT   CDS             211575..211892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0221"
FT                   /product="thioredoxin"
FT                   /note="COGs: COG3118 Thioredoxin domain-containing protein;
FT                   InterProIPR017937: IPR005746: IPR006662: IPR017936: IPR
FT                   013766; KEGG: wsu:WS0452 thioredoxin; PFAM: Thioredoxin
FT                   domain-containing protein; SPTR: THIOREDOXIN; TIGRFAM:
FT                   thioredoxin; PFAM: Thioredoxin; TIGRFAM: thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32888"
FT                   /db_xref="GOA:E4TXX5"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX5"
FT                   /protein_id="ADR32888.1"
FT                   /translation="MGKYVELTVSNFDEITKEGVSLVDFWAPWCGPCRMIAPVIEELAA
FT                   EYEGKANICKVNTDEEQDIAVKYGIRSIPTILFFKNGEVVEQMVGAASKQAFADKLNAL
FT                   L"
     MGKYVELTVS NFDEITKEGV SLVDFWAPWC GPCRMIAPVI EELAAEYEGK ANICKVNTDE        60
     EQDIAVKYGI RSIPTILFFK NGEVVEQMVG AASKQAFADK LNALL                       105
//

If you have problems or comments...

PBIL Back to PBIL home page