(data stored in ACNUC7421 zone)

EMBL: CP002355.PE223

CP002355.PE223       Location/Qualifiers
FT   CDS             213882..215231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0224"
FT                   /product="amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="COGs: COG0034 Glutamine phosphoribosylpyrophosphate
FT                   amidotransferase; InterPro IPR005854: IPR017932: IPR000583:
FT                   IPR000836; KEGG: tdn:Suden_1871
FT                   amidophosphoribosyltransferase; PFAM: glutamine
FT                   amidotransferase class-II; phosphoribosyltransferase; SPTR:
FT                   Amidophosphoribosyltransferase; TIGRFAM:
FT                   amidophosphoribosyltransferase; PFAM: Phosphoribosyl
FT                   transferase domain; Glutamine amidotransferases class-II;
FT                   TIGRFAM: amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32891"
FT                   /db_xref="GOA:E4TXX8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX8"
FT                   /protein_id="ADR32891.1"
FT                   /translation="MRSLNEKCAVVGIFDHPEASKLAYFSLHALQHRGQEAAGISTGDG
FT                   EKLYTIKDRGLVTQVFDTQKLNTLKGHMAIGHTRYSTAGDDSILDAQPVFARYDLGEMS
FT                   IVHNGNLTNAKEVRDALIKKGAIFQTYMDTENLIHLIAKSDQHHLTDRIIDAVKKIEGA
FT                   YSLVFLSRTKMFAMRDPHGFRPLSLGRVGDGYVVASETCAFDLIGAEYIRDVEPGELLI
FT                   FEKGKAPKSIKVFEPTPKHCIFEYVYFARPDSNVYNQNVYEMRKAMGKALAQEQPIEAD
FT                   MVVPVPDGGVPAAIGYSQQSGIPFEMAIMRNHYIGRTFIEPTQEMRDLKVKMKLSPIND
FT                   LIRGKRLIVIDDSIVRGTTSRQIVRMLKAAGASEVHMRISSPPTTDPCYYGVDTPDKEK
FT                   LIAANMTNEEICAFIEADSLGYLSNEALLASVNGKEENYCTACFTGKYII"
     MRSLNEKCAV VGIFDHPEAS KLAYFSLHAL QHRGQEAAGI STGDGEKLYT IKDRGLVTQV        60
     FDTQKLNTLK GHMAIGHTRY STAGDDSILD AQPVFARYDL GEMSIVHNGN LTNAKEVRDA       120
     LIKKGAIFQT YMDTENLIHL IAKSDQHHLT DRIIDAVKKI EGAYSLVFLS RTKMFAMRDP       180
     HGFRPLSLGR VGDGYVVASE TCAFDLIGAE YIRDVEPGEL LIFEKGKAPK SIKVFEPTPK       240
     HCIFEYVYFA RPDSNVYNQN VYEMRKAMGK ALAQEQPIEA DMVVPVPDGG VPAAIGYSQQ       300
     SGIPFEMAIM RNHYIGRTFI EPTQEMRDLK VKMKLSPIND LIRGKRLIVI DDSIVRGTTS       360
     RQIVRMLKAA GASEVHMRIS SPPTTDPCYY GVDTPDKEKL IAANMTNEEI CAFIEADSLG       420
     YLSNEALLAS VNGKEENYCT ACFTGKYII                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page