(data stored in ACNUC7421 zone)

EMBL: CP002355.PE224

CP002355.PE224       Location/Qualifiers
FT   CDS             215347..216309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="COGs: COG1242 Fe-S oxidoreductase; InterPro
FT                   IPR005911: IPR007197: IPR006638; KEGG: tdn:Suden_1872
FT                   hypothetical protein; PFAM: Radical SAM domain protein;
FT                   SMART: Elongator protein 3/MiaB/NifB; SPTR: Putative
FT                   uncharacterized protein; TIGRFAM: conserved hypothetical
FT                   protein; PFAM: Radical SAM superfamily; TIGRFAM: radical
FT                   SAM protein, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32892"
FT                   /db_xref="GOA:E4TXX9"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXX9"
FT                   /protein_id="ADR32892.1"
FT                   /translation="MRTQIFTFGQYLHRRFGAKVSKVPVSISGFTCPNIDGSVAKGGCT
FT                   FCENDSFSPSLDRARELKGFYLNLQSTSNPHLEKQLQQLEWQFQALSSRLSDENNAQKF
FT                   LVYFQSFTNTYAPLETLKALYEKALTFDNVVGLSIGTRSDSISDETFEYLADLSQKTEI
FT                   WIEFGIQSIYDTTLERINRGHDSANVKEAIRKAKSYGLNVCGHLIFGLPGETKEMMLET
FT                   AKEAYALGIDSVKYHPLYVVKRTALANEYARGEFEPIDEELYLEVLREAIVLKPSHVSV
FT                   QRISAGIGDESLIAPQWCKDKNRQLRSINKALESVGLKY"
     MRTQIFTFGQ YLHRRFGAKV SKVPVSISGF TCPNIDGSVA KGGCTFCEND SFSPSLDRAR        60
     ELKGFYLNLQ STSNPHLEKQ LQQLEWQFQA LSSRLSDENN AQKFLVYFQS FTNTYAPLET       120
     LKALYEKALT FDNVVGLSIG TRSDSISDET FEYLADLSQK TEIWIEFGIQ SIYDTTLERI       180
     NRGHDSANVK EAIRKAKSYG LNVCGHLIFG LPGETKEMML ETAKEAYALG IDSVKYHPLY       240
     VVKRTALANE YARGEFEPID EELYLEVLRE AIVLKPSHVS VQRISAGIGD ESLIAPQWCK       300
     DKNRQLRSIN KALESVGLKY                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page