(data stored in ACNUC7421 zone)

EMBL: CP002355.PE225

CP002355.PE225       Location/Qualifiers
FT   CDS             complement(216317..216850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0226"
FT                   /product="DNA gyrase subunit B"
FT                   /note="KEGG: cco:CCC13826_2105 DNA gyrase subunit B; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32893"
FT                   /db_xref="GOA:E4TXY0"
FT                   /db_xref="InterPro:IPR013417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY0"
FT                   /protein_id="ADR32893.1"
FT                   /translation="MSPLTIWHYLLIAVLILLLLIGFLVSLRTNSKFSVFTTISLTLML
FT                   IGFFTWRSINENVYIVEVSQLDQERFYQSEQIVLKGIVRNVGNYPVANVIATVKLINSH
FT                   GGVGGKQSLFTQPSVFAQIYEGDNPNFKRQTVEKEELVADYLNPGKAKPFTIIMKYPSY
FT                   FKHATFDVTAKAAY"
     MSPLTIWHYL LIAVLILLLL IGFLVSLRTN SKFSVFTTIS LTLMLIGFFT WRSINENVYI        60
     VEVSQLDQER FYQSEQIVLK GIVRNVGNYP VANVIATVKL INSHGGVGGK QSLFTQPSVF       120
     AQIYEGDNPN FKRQTVEKEE LVADYLNPGK AKPFTIIMKY PSYFKHATFD VTAKAAY          177
//

If you have problems or comments...

PBIL Back to PBIL home page