(data stored in ACNUC7421 zone)

EMBL: CP002355.PE226

CP002355.PE226       Location/Qualifiers
FT   CDS             complement(216847..217362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1874 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32894"
FT                   /db_xref="GOA:E4TXY1"
FT                   /db_xref="InterPro:IPR013417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY1"
FT                   /protein_id="ADR32894.1"
FT                   /translation="MKTKIIDFIHHLIIYDYLLFGGIFILFLLFLVLAIALRHKMALAV
FT                   LFVVLAFGTLTAGSVAGYIQLHKYLFKNKIILHEVKALQYTEALLIKGDINNTSKRSFK
FT                   ECTITTGVYKVTHNKYLDRVYPYVPFKKSSQKFIKPIPPGESKPFKLFVEPFRYTKDYN
FT                   ITIKAECR"
     MKTKIIDFIH HLIIYDYLLF GGIFILFLLF LVLAIALRHK MALAVLFVVL AFGTLTAGSV        60
     AGYIQLHKYL FKNKIILHEV KALQYTEALL IKGDINNTSK RSFKECTITT GVYKVTHNKY       120
     LDRVYPYVPF KKSSQKFIKP IPPGESKPFK LFVEPFRYTK DYNITIKAEC R                171
//

If you have problems or comments...

PBIL Back to PBIL home page