(data stored in ACNUC7421 zone)

EMBL: CP002355.PE227

CP002355.PE227       Location/Qualifiers
FT   CDS             complement(217359..218033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0228"
FT                   /product="phosphoribosyl-AMP cyclohydrolase;
FT                   phosphoribosyl-ATP pyrophosphatase"
FT                   /EC_number="3.6.1.31"
FT                   /EC_number="3.5.4.19"
FT                   /note="COGs: COG0139 Phosphoribosyl-AMP cyclohydrolase;
FT                   InterPro IPR008179: IPR002496: IPR021130; KEGG:
FT                   tdn:Suden_1875 phosphoribosyl-AMP cyclohydrolase; PFAM:
FT                   phosphoribosyl-AMP cyclohydrolase; Phosphoribosyl-ATP
FT                   pyrophosphohydrolase-like; SPTR: Histidine biosynthesis
FT                   bifunctional protein hisIE; TIGRFAM: phosphoribosyl-ATP
FT                   diphosphatase; PFAM: Phosphoribosyl-ATP
FT                   pyrophosphohydrolase; Phosphoribosyl-AMP cyclohydrolase;
FT                   TIGRFAM: phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32895"
FT                   /db_xref="GOA:E4TXY2"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY2"
FT                   /protein_id="ADR32895.1"
FT                   /translation="MNLDLIDWQKSELLPVIVQDSTTLEVLMMAYMNREALELSLSTRI
FT                   AHYYSRSKKRLWKKGESSGHLQHIEQFLLDCDNDTLLLIVRQEGVACHTGRKSCFFTNI
FT                   ESGEAISRPLIDTAATYGIIDELYHTILSRKNADPSTSWTAKLLSKGDNTILKKVVEEA
FT                   GEFSFAIKDGNEDEIIYECADLVYHVLVALGHKNISPDRIKQELARRFGMSGIAEKNSR
FT                   EQ"
     MNLDLIDWQK SELLPVIVQD STTLEVLMMA YMNREALELS LSTRIAHYYS RSKKRLWKKG        60
     ESSGHLQHIE QFLLDCDNDT LLLIVRQEGV ACHTGRKSCF FTNIESGEAI SRPLIDTAAT       120
     YGIIDELYHT ILSRKNADPS TSWTAKLLSK GDNTILKKVV EEAGEFSFAI KDGNEDEIIY       180
     ECADLVYHVL VALGHKNISP DRIKQELARR FGMSGIAEKN SREQ                        224
//

If you have problems or comments...

PBIL Back to PBIL home page