(data stored in ACNUC7421 zone)

EMBL: CP002355.PE228

CP002355.PE228       Location/Qualifiers
FT   CDS             complement(218104..219141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0229"
FT                   /product="SPFH domain, Band 7 family protein"
FT                   /note="COGs: COG0330 Membrane protease subunits
FT                   stomatin/prohibitin homologs; InterPro IPR000163:
FT                   IPR001107; KEGG: tdn:Suden_1876 band 7 protein; PFAM: band
FT                   7 protein; SMART: band 7 protein; SPTR: Band 7 protein;
FT                   PFAM: SPFH domain / Band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32896"
FT                   /db_xref="GOA:E4TXY3"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY3"
FT                   /protein_id="ADR32896.1"
FT                   /translation="MASDMNDYFNKKKNEANRGGGFQSPKPPKMDFNLSGQKAGMLWII
FT                   GGILLLLVLAKPFIIITEGERGILSTNGKYEERALLPGLHFLIPFIQKVYLVDTKVRII
FT                   NYADKIDRASTAGDGIVLKPAITVLDKRGLPVTIELTVQYRLNPQVAAQTISNWGFSWE
FT                   DKIIDPVARDIVRNVVGQYEAENLPIMRNAIAQKIEVGIRNTVEGQKNAPAQLESIQLR
FT                   EIGLPQKVKDQIERVQVAKQEVERAQQDVERAKQEAFKKETEAQGTANAITIQAEAQAK
FT                   ANRLIGSSLTPGLLKLEQIQVQGKFNEALKENKDAKIFLTPGGSTPNIWLDTKTGDGQK
FT                   ISSTK"
     MASDMNDYFN KKKNEANRGG GFQSPKPPKM DFNLSGQKAG MLWIIGGILL LLVLAKPFII        60
     ITEGERGILS TNGKYEERAL LPGLHFLIPF IQKVYLVDTK VRIINYADKI DRASTAGDGI       120
     VLKPAITVLD KRGLPVTIEL TVQYRLNPQV AAQTISNWGF SWEDKIIDPV ARDIVRNVVG       180
     QYEAENLPIM RNAIAQKIEV GIRNTVEGQK NAPAQLESIQ LREIGLPQKV KDQIERVQVA       240
     KQEVERAQQD VERAKQEAFK KETEAQGTAN AITIQAEAQA KANRLIGSSL TPGLLKLEQI       300
     QVQGKFNEAL KENKDAKIFL TPGGSTPNIW LDTKTGDGQK ISSTK                       345
//

If you have problems or comments...

PBIL Back to PBIL home page