(data stored in ACNUC7421 zone)

EMBL: CP002355.PE229

CP002355.PE229       Location/Qualifiers
FT   CDS             complement(219196..220116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0230"
FT                   /product="branched chain amino acid aminotransferase
FT                   apoenzyme"
FT                   /EC_number="2.6.1.42"
FT                   /note="COGs: COG0115 Branched-chain amino acid
FT                   aminotransferase/4-amino-4-deoxychorismate lyase; InterPro
FT                   IPR005785: IPR001544; KEGG: tdn:Suden_1877 branched-chain
FT                   amino acid aminotransferase; PFAM: aminotransferase class
FT                   IV; SPTR: Branched-chain amino acid aminotransferase;
FT                   TIGRFAM: branched-chain amino acid aminotransferase; PFAM:
FT                   Aminotransferase class IV; TIGRFAM: branched-chain amino
FT                   acid aminotransferase, group I"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32897"
FT                   /db_xref="GOA:E4TXY4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY4"
FT                   /protein_id="ADR32897.1"
FT                   /translation="MNEAKYIWMNGKLLPWHDAKIHVLSHTLHYGNGAIEGTKAYKTPK
FT                   GYAIFRLNDHTKRLIESAKMTLINVPYTVEELNHAQIELLKANEFTGENVYLRPIVYLG
FT                   YGVMGVYHKEAPVEVAVSAWEWGAYLGEEGMKKGIRLKISSFSRPNNKSNMGKAKAVAN
FT                   YLNSQMAKFEAVEAGYDEALLLDDEGYVAEASGASFFMIKDGEIITPPNDNSLASITQK
FT                   TVIEMAEKMGYTVSRRRISREEIYIADEAFLTGTAAEITPVREVDARVLGAGGRGPITE
FT                   KIQSSYFDIVYGRNPDYDHYLTYIN"
     MNEAKYIWMN GKLLPWHDAK IHVLSHTLHY GNGAIEGTKA YKTPKGYAIF RLNDHTKRLI        60
     ESAKMTLINV PYTVEELNHA QIELLKANEF TGENVYLRPI VYLGYGVMGV YHKEAPVEVA       120
     VSAWEWGAYL GEEGMKKGIR LKISSFSRPN NKSNMGKAKA VANYLNSQMA KFEAVEAGYD       180
     EALLLDDEGY VAEASGASFF MIKDGEIITP PNDNSLASIT QKTVIEMAEK MGYTVSRRRI       240
     SREEIYIADE AFLTGTAAEI TPVREVDARV LGAGGRGPIT EKIQSSYFDI VYGRNPDYDH       300
     YLTYIN                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page