(data stored in ACNUC7421 zone)

EMBL: CP002355.PE23

CP002355.PE23        Location/Qualifiers
FT   CDS             complement(25069..26409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0023"
FT                   /product="adenosylcobyric acid synthase
FT                   (glutamine-hydrolysing)"
FT                   /EC_number="6.3.5.10"
FT                   /note="COGs: COG1492 Cobyric acid synthase; InterPro
FT                   IPR004459: IPR017929: IPR011698; KEGG: ant:Arnit_1837
FT                   cobyric acid synthase CobQ; PFAM: CobB/CobQ domain protein
FT                   glutamine amidotransferase; SPTR: Cobyric acid synthase
FT                   CobQ; TIGRFAM: cobyric acid synthase CobQ; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyric acid synthase CobQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32691"
FT                   /db_xref="GOA:E4TW75"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW75"
FT                   /protein_id="ADR32691.1"
FT                   /translation="MRSISIFGTSSDAGKSTLTFVIGRLLQERGINVGVFKAQNVSNNS
FT                   RVCDDGSEIAVAQYFQAEVLGIPTSYHLNPVLLKSGHGNSASLIVKGRVVEDKEVREYY
FT                   RDLDQLKPAVNECFEYLSERYECLVCEGAGSPVELNLMDKDLSNIYIAQKYNTKIILVA
FT                   DIERGGVFASIWGVYNLLPEALRKNVIGVIINKFRGDRSLFDEGVTIIEERFGIPVLGV
FT                   LPYLPLNLGFEDSQSLKNFIQNKPHPAQKIGIIAYPTMSNYNDFEPLIADESIFVEFIT
FT                   SNVALESFDCVILPGSKRVIEDLRWLKKTGLFDAIQKREKEILGICGGYQMMFTEIIDE
FT                   ECVETPEPSREEALGFIDDAIVFQKEKVLTKGEYSIFGKTVRGFEIHHGVSGKYPLWYE
FT                   KGHIKGTFVHGLFEDEAFEEYKQKTVGDFIATMRDEIDMERILEHVL"
     MRSISIFGTS SDAGKSTLTF VIGRLLQERG INVGVFKAQN VSNNSRVCDD GSEIAVAQYF        60
     QAEVLGIPTS YHLNPVLLKS GHGNSASLIV KGRVVEDKEV REYYRDLDQL KPAVNECFEY       120
     LSERYECLVC EGAGSPVELN LMDKDLSNIY IAQKYNTKII LVADIERGGV FASIWGVYNL       180
     LPEALRKNVI GVIINKFRGD RSLFDEGVTI IEERFGIPVL GVLPYLPLNL GFEDSQSLKN       240
     FIQNKPHPAQ KIGIIAYPTM SNYNDFEPLI ADESIFVEFI TSNVALESFD CVILPGSKRV       300
     IEDLRWLKKT GLFDAIQKRE KEILGICGGY QMMFTEIIDE ECVETPEPSR EEALGFIDDA       360
     IVFQKEKVLT KGEYSIFGKT VRGFEIHHGV SGKYPLWYEK GHIKGTFVHG LFEDEAFEEY       420
     KQKTVGDFIA TMRDEIDMER ILEHVL                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page