(data stored in ACNUC7421 zone)

EMBL: CP002355.PE230

CP002355.PE230       Location/Qualifiers
FT   CDS             complement(220226..220675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0231"
FT                   /product="globin"
FT                   /note="COGs: COG2346 Truncated hemoglobins; InterPro
FT                   IPR001486; KEGG: abu:Abu_1553 hypothetical protein; PFAM:
FT                   globin; SPTR: Protozoan/cyanobacterial globin family
FT                   protein; PFAM: Bacterial-like globin"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32898"
FT                   /db_xref="GOA:E4TXY5"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY5"
FT                   /protein_id="ADR32898.1"
FT                   /translation="MLELKITDGVLGVRPPVTKPHPGFFFQVGEERFRKLVDDHYEKIR
FT                   NSDIAFLFPVNDEEDFANAKKHAADFLIQICGGPDYFAQTRGEPRMVGRHAPFRIDEHG
FT                   RRRWLEFYAELLPPLEAEGINPEYIQSFWDYLDIFSIWMINTPSH"
     MLELKITDGV LGVRPPVTKP HPGFFFQVGE ERFRKLVDDH YEKIRNSDIA FLFPVNDEED        60
     FANAKKHAAD FLIQICGGPD YFAQTRGEPR MVGRHAPFRI DEHGRRRWLE FYAELLPPLE       120
     AEGINPEYIQ SFWDYLDIFS IWMINTPSH                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page