(data stored in ACNUC7421 zone)

EMBL: CP002355.PE233

CP002355.PE233       Location/Qualifiers
FT   CDS             complement(222738..224267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0234"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abu:Abu_0069 hypothetical protein; SPTR:
FT                   Putative uncharacterized protein; PFAM: Protein of unknown
FT                   function (DUF3373)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32901"
FT                   /db_xref="InterPro:IPR021803"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY8"
FT                   /protein_id="ADR32901.1"
FT                   /translation="MKQRILGSVITAALLTTNAFSDDSLIQRFEKMEREMAALKAELES
FT                   IKAENSRLSTQLSTPSNTNSKQDATTSANINETLEDIQDQISTINKKTNGDNLKFGVDF
FT                   RTSVDNLHYKMADGSTHKNDAVFSNRLWLNMGYAANKNISFTGQLAYNKIFGERAQTTQ
FT                   SPAMEGFDWISGESAYDDTLRVRSAYFLYTDDELAGLEIPWTFSIGRRPSTEGHLINFR
FT                   DDVKTSSPLAHAINVEFDGASAKFGTEELTGLAGSYFKLCAGRGMSEAEPRFSSAPYTG
FT                   NGSSKTNNIDMAGIIVVPYDDKQFSTGFQYTYANNLIDQEAPGGNMETVGGLHTATAFA
FT                   MVNGIGDGWSEFLDDSLIFISGAVSKTDPYKGSGKQGMLGSFDSETGYSYWIGTQFPSL
FT                   ISEEGRWGIEFNHGSSFWRPLTYGEDTLIGSKIAARGDAYEVYFTEPLVDDILTFQLRY
FT                   TYINYDYSGSNGFFGSVTGTPMSMDQAIGAGYGDNVVDKAQDIRAYLRYKF"
     MKQRILGSVI TAALLTTNAF SDDSLIQRFE KMEREMAALK AELESIKAEN SRLSTQLSTP        60
     SNTNSKQDAT TSANINETLE DIQDQISTIN KKTNGDNLKF GVDFRTSVDN LHYKMADGST       120
     HKNDAVFSNR LWLNMGYAAN KNISFTGQLA YNKIFGERAQ TTQSPAMEGF DWISGESAYD       180
     DTLRVRSAYF LYTDDELAGL EIPWTFSIGR RPSTEGHLIN FRDDVKTSSP LAHAINVEFD       240
     GASAKFGTEE LTGLAGSYFK LCAGRGMSEA EPRFSSAPYT GNGSSKTNNI DMAGIIVVPY       300
     DDKQFSTGFQ YTYANNLIDQ EAPGGNMETV GGLHTATAFA MVNGIGDGWS EFLDDSLIFI       360
     SGAVSKTDPY KGSGKQGMLG SFDSETGYSY WIGTQFPSLI SEEGRWGIEF NHGSSFWRPL       420
     TYGEDTLIGS KIAARGDAYE VYFTEPLVDD ILTFQLRYTY INYDYSGSNG FFGSVTGTPM       480
     SMDQAIGAGY GDNVVDKAQD IRAYLRYKF                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page