(data stored in ACNUC7421 zone)

EMBL: CP002355.PE234

CP002355.PE234       Location/Qualifiers
FT   CDS             224571..225347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0235"
FT                   /product="SSU ribosomal protein S2P"
FT                   /note="COGs: COG0052 Ribosomal protein S2; InterPro
FT                   IPR018130: IPR005706: IPR001865; KEGG: tdn:Suden_1802 30S
FT                   ribosomal protein S2; PFAM: ribosomal protein S2; SPTR: 30S
FT                   ribosomal protein S2; TIGRFAM: ribosomal protein S2; PFAM:
FT                   Ribosomal protein S2; TIGRFAM: ribosomal protein S2,
FT                   bacterial type"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32902"
FT                   /db_xref="GOA:E4TXY9"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXY9"
FT                   /protein_id="ADR32902.1"
FT                   /translation="MVTMKDLLECGVHFGHQTRRWNPKMKKYIFGVRKNIYIIDLQKTL
FT                   RYFRNAYQQVVDAAAEGKTVLFVGTKKQARVAIRDAAVACGMPYVDNRWLGGMLTNFPT
FT                   IQKSIRKLDIIEEMQANGQINLLTKKEALMMNRQKEKLIAYLGGIRHMKTLPDMMFVID
FT                   AVKEHIAVQEARNLGIQVVAPLDTNCDPDVIDIPIPGNDDAIRSIQLFCKEMAEAINEG
FT                   KALRNGGNDEAVAEEEVAPEAAAVEAATEEVVAEEA"
     MVTMKDLLEC GVHFGHQTRR WNPKMKKYIF GVRKNIYIID LQKTLRYFRN AYQQVVDAAA        60
     EGKTVLFVGT KKQARVAIRD AAVACGMPYV DNRWLGGMLT NFPTIQKSIR KLDIIEEMQA       120
     NGQINLLTKK EALMMNRQKE KLIAYLGGIR HMKTLPDMMF VIDAVKEHIA VQEARNLGIQ       180
     VVAPLDTNCD PDVIDIPIPG NDDAIRSIQL FCKEMAEAIN EGKALRNGGN DEAVAEEEVA       240
     PEAAAVEAAT EEVVAEEA                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page