(data stored in ACNUC7421 zone)

EMBL: CP002355.PE235

CP002355.PE235       Location/Qualifiers
FT   CDS             225350..226417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0236"
FT                   /product="translation elongation factor Ts (EF-Ts)"
FT                   /note="COGs: COG0264 Translation elongation factor Ts;
FT                   InterPro IPR018101: IPR001816: IPR000449: IPR014039; KEGG:
FT                   tdn:Suden_1801 elongation factor Ts; PFAM: Translation
FT                   elongation factor EFTs/EF1B dimerisation;
FT                   ubiquitin-associated- domain-containing protein; SPTR:
FT                   Elongation factor Ts; TIGRFAM: translation elongation
FT                   factor Ts; PFAM: Elongation factor TS; UBA/TS-N domain;
FT                   TIGRFAM: translation elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32903"
FT                   /db_xref="GOA:E4TXZ0"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ0"
FT                   /protein_id="ADR32903.1"
FT                   /translation="MAEITAAMVKDLRTATDAPMMDCKKALTECDGDMEKAKDWLRDRG
FT                   MAQTAKKADRVAAEGLLGLKVSETFSSASLVEINSETDFVAKNDGFIALVGNTAAHVFT
FT                   TGVSTVEELNETSYETGTFSEYFTSQVARIGEKIVTRRFVTLNAGENGCVNGYVHSNGR
FT                   VGVLVAAACSDAKVAEAMAPMLKNVAMHAAAMKPTTLTSKDFDPAFVEAETIGRIEAIK
FT                   TENEELARLKKPLKNVPQYISACQLTPEVMAAAEEAIKAELAAEGKPEKIWANIIPGKL
FT                   ARFVADNTTLDKELALLDQNYVMDDSLTVAEAITKEAAKHGGTAELVEFVKYEVGEGIE
FT                   KQVNDFAAEVAAQMS"
     MAEITAAMVK DLRTATDAPM MDCKKALTEC DGDMEKAKDW LRDRGMAQTA KKADRVAAEG        60
     LLGLKVSETF SSASLVEINS ETDFVAKNDG FIALVGNTAA HVFTTGVSTV EELNETSYET       120
     GTFSEYFTSQ VARIGEKIVT RRFVTLNAGE NGCVNGYVHS NGRVGVLVAA ACSDAKVAEA       180
     MAPMLKNVAM HAAAMKPTTL TSKDFDPAFV EAETIGRIEA IKTENEELAR LKKPLKNVPQ       240
     YISACQLTPE VMAAAEEAIK AELAAEGKPE KIWANIIPGK LARFVADNTT LDKELALLDQ       300
     NYVMDDSLTV AEAITKEAAK HGGTAELVEF VKYEVGEGIE KQVNDFAAEV AAQMS            355
//

If you have problems or comments...

PBIL Back to PBIL home page