(data stored in ACNUC7421 zone)

EMBL: CP002355.PE236

CP002355.PE236       Location/Qualifiers
FT   CDS             226505..227146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0237"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1136 ABC-type antimicrobial peptide
FT                   transport system ATPase component; InterPro IPR017871:
FT                   IPR003439: IPR003593; KEGG: tdn:Suden_1799 ABC
FT                   transporter-related protein; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase; SPTR: Lipoprotein-releasing system
FT                   ATP-binding protein LolD; manually curated; PFAM: ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32904"
FT                   /db_xref="GOA:E4TXZ1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ1"
FT                   /protein_id="ADR32904.1"
FT                   /translation="MTLLKATSLSHAFDYPLFEDISMTLNEGESIAIVGVSGSGKSTLM
FT                   HILSSLLHPLKGNVELFGEDIYRLDDKSLVKLRRNDLGMIYQSHYLFKGFSAYENLEVA
FT                   TLLSGEKIDPTLLKRLGIDHVINQKVTELSGGQQQRVSIARVMSKKPRLIFADEPTGNL
FT                   DHATALEVMEIFDDYLREHKAAMILVTHDEALAERCTHVYRMQNGSLKEM"
     MTLLKATSLS HAFDYPLFED ISMTLNEGES IAIVGVSGSG KSTLMHILSS LLHPLKGNVE        60
     LFGEDIYRLD DKSLVKLRRN DLGMIYQSHY LFKGFSAYEN LEVATLLSGE KIDPTLLKRL       120
     GIDHVINQKV TELSGGQQQR VSIARVMSKK PRLIFADEPT GNLDHATALE VMEIFDDYLR       180
     EHKAAMILVT HDEALAERCT HVYRMQNGSL KEM                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page