(data stored in ACNUC7421 zone)

EMBL: CP002355.PE237

CP002355.PE237       Location/Qualifiers
FT   CDS             227151..227915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0238"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="COGs: COG1684 Flagellar biosynthesis pathway
FT                   component FliR; InterPro IPR006303: IPR002010; KEGG:
FT                   tdn:Suden_1798 flagellar biosynthesis protein FliR; PFAM:
FT                   type III secretion system inner membrane R protein; SPTR:
FT                   Flagellar biosynthetic protein fliR; TIGRFAM: flagellar
FT                   biosynthetic protein FliR; PFAM: Bacterial export proteins,
FT                   family 1; TIGRFAM: flagellar biosynthetic protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32905"
FT                   /db_xref="GOA:E4TXZ2"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ2"
FT                   /protein_id="ADR32905.1"
FT                   /translation="MEWAEIFSEGRTIAFILLFIRFGALFMAVPIFSHMNIPISIKAAM
FT                   AFFFTVFFFGAVPPLHIPTDTLSLTVAILGEMLFGLAVGIVLQLAYHVITFAGGQISFM
FT                   MGFSLASAIDPQSGVSMPIISQFLSLLALMILLIFDLHHWILLYASQSISTVPLGGFLM
FT                   TPSLFKYIMHAMTNMFVVGFMIAFPITALSMLADLIFGMLMKTMPQFNLLVIGMPIKIA
FT                   VSFVVLMATLGATLMIVTSQTQNAYNFLEKLF"
     MEWAEIFSEG RTIAFILLFI RFGALFMAVP IFSHMNIPIS IKAAMAFFFT VFFFGAVPPL        60
     HIPTDTLSLT VAILGEMLFG LAVGIVLQLA YHVITFAGGQ ISFMMGFSLA SAIDPQSGVS       120
     MPIISQFLSL LALMILLIFD LHHWILLYAS QSISTVPLGG FLMTPSLFKY IMHAMTNMFV       180
     VGFMIAFPIT ALSMLADLIF GMLMKTMPQF NLLVIGMPIK IAVSFVVLMA TLGATLMIVT       240
     SQTQNAYNFL EKLF                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page