(data stored in ACNUC7421 zone)

EMBL: CP002355.PE238

CP002355.PE238       Location/Qualifiers
FT   CDS             complement(227907..228383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nis:NIS_1499 nuclease NucT; SPTR: Membrane
FT                   bound endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32906"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ3"
FT                   /protein_id="ADR32906.1"
FT                   /translation="MIKLLVLLFIFVSVYAQETIFKLPDNHSRFLHQLDRSFKTASQIL
FT                   IITPSLHHSDLSKKLLSAIKKGTTVTLTVQETKGDPLSLIQYKNIELYLSEVKLDQTLI
FT                   LVDDSLVCTSDGTINEELFRSAHSVIRCSDNPNKIRSIRNASYPFIQHARPYLE"
     MIKLLVLLFI FVSVYAQETI FKLPDNHSRF LHQLDRSFKT ASQILIITPS LHHSDLSKKL        60
     LSAIKKGTTV TLTVQETKGD PLSLIQYKNI ELYLSEVKLD QTLILVDDSL VCTSDGTINE       120
     ELFRSAHSVI RCSDNPNKIR SIRNASYPFI QHARPYLE                               158
//

If you have problems or comments...

PBIL Back to PBIL home page