(data stored in ACNUC7421 zone)

EMBL: CP002355.PE239

CP002355.PE239       Location/Qualifiers
FT   CDS             228463..229947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0240"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tdn:Suden_1797 hypothetical protein; SPTR: DNA
FT                   topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32907"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ4"
FT                   /protein_id="ADR32907.1"
FT                   /translation="MKILLFNDNPVVRKLVALSAQKTKDDLSVVWSTDEIEGNEYDLLI
FT                   VDDALYSDEILDSINEKIVAKNTLFMATRGKAVPSGFDNVINKPFLPTDLVDMFVQIEK
FT                   KVSVGRDQSDNEVEEHASSTSTYAINLEDSLSELEGDETEALVGAEDDLDFGDLDDYED
FT                   KLPETAILDQEEVQEVQELLEDTEEDDLTMDDEFSVEGSAPISLPDEEIGVPIELEDDF
FT                   SLDDANIIDEEKEEEELLGFDDIEENEIPSDEEVPKNDLSEDDEFGDLELPEPLEESSG
FT                   LSDEDELLSMGEDDALGELELPEDDGLSDMNDATSFDLSGLEEMDESMLMDDDELGDLE
FT                   SKIEDAVGGLESEELERELETDDFDLSLNDEMMEELMSTEEENLMDTGSFDELDMLDER
FT                   ELKIAVGEEVEEEDEPVLVAKGGSSLAAEALDEVLNESSPYAEFTDEIEEAEPVASHAE
FT                   GVEALQALLKALSNENVSKSLKGMNISININFGNGA"
     MKILLFNDNP VVRKLVALSA QKTKDDLSVV WSTDEIEGNE YDLLIVDDAL YSDEILDSIN        60
     EKIVAKNTLF MATRGKAVPS GFDNVINKPF LPTDLVDMFV QIEKKVSVGR DQSDNEVEEH       120
     ASSTSTYAIN LEDSLSELEG DETEALVGAE DDLDFGDLDD YEDKLPETAI LDQEEVQEVQ       180
     ELLEDTEEDD LTMDDEFSVE GSAPISLPDE EIGVPIELED DFSLDDANII DEEKEEEELL       240
     GFDDIEENEI PSDEEVPKND LSEDDEFGDL ELPEPLEESS GLSDEDELLS MGEDDALGEL       300
     ELPEDDGLSD MNDATSFDLS GLEEMDESML MDDDELGDLE SKIEDAVGGL ESEELERELE       360
     TDDFDLSLND EMMEELMSTE EENLMDTGSF DELDMLDERE LKIAVGEEVE EEDEPVLVAK       420
     GGSSLAAEAL DEVLNESSPY AEFTDEIEEA EPVASHAEGV EALQALLKAL SNENVSKSLK       480
     GMNISININF GNGA                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page