(data stored in ACNUC7421 zone)

EMBL: CP002355.PE24

CP002355.PE24        Location/Qualifiers
FT   CDS             complement(26406..27269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0024"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="COGs: COG1270 Cobalamin biosynthesis protein
FT                   CobD/CbiB; InterPro IPR004485; KEGG: ant:Arnit_1844
FT                   cobalamin biosynthesis protein CobD; PFAM: cobalamin
FT                   biosynthesis protein CbiB; SPTR: Cobalamin biosynthesis
FT                   protein CobD; TIGRFAM: cobalamin biosynthesis protein CobD;
FT                   PFAM: CobD/Cbib protein; TIGRFAM: cobalamin biosynthesis
FT                   protein CobD"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32692"
FT                   /db_xref="GOA:E4TW76"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW76"
FT                   /protein_id="ADR32692.1"
FT                   /translation="MFFGVALIAYITDRLFGEFPFIRHPIVLMGDFITAFQKRFYRDSI
FT                   LRGFWLVFWLLAAVLAIVTPITLIGNPWILGIIASTGIAGKMLYESVNNVLSDPSSIRY
FT                   LVSRDTQNLSESEINKAAIETYAENLSDGVIAPLFYLLVFGLVGLFLYKAVNTLDSMVG
FT                   YRNERYEKFGKVSARLDDLLNYLPSRITAVIILTFFGKLSALKKTWHYGAQHESPNAGY
FT                   PIAAMALSLYVSLGGPTSYFGTIKNKPYFGEGKREITDGDVRSALALQWKLDTLVILLL
FT                   AAGVYA"
     MFFGVALIAY ITDRLFGEFP FIRHPIVLMG DFITAFQKRF YRDSILRGFW LVFWLLAAVL        60
     AIVTPITLIG NPWILGIIAS TGIAGKMLYE SVNNVLSDPS SIRYLVSRDT QNLSESEINK       120
     AAIETYAENL SDGVIAPLFY LLVFGLVGLF LYKAVNTLDS MVGYRNERYE KFGKVSARLD       180
     DLLNYLPSRI TAVIILTFFG KLSALKKTWH YGAQHESPNA GYPIAAMALS LYVSLGGPTS       240
     YFGTIKNKPY FGEGKREITD GDVRSALALQ WKLDTLVILL LAAGVYA                     287
//

If you have problems or comments...

PBIL Back to PBIL home page