(data stored in ACNUC7421 zone)

EMBL: CP002355.PE240

CP002355.PE240       Location/Qualifiers
FT   CDS             229944..230564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0241"
FT                   /product="guanylate kinase"
FT                   /EC_number="2.7.4.8"
FT                   /note="COGs: COG0194 Guanylate kinase; InterPro IPR020590:
FT                   IPR017665: IPR008144: IPR008145; KEGG: tdn:Suden_1796
FT                   guanylate kinase; PFAM: guanylate kinase; PRIAM: Guanylate
FT                   kinase; SMART: guanylate kinase/L-type calcium channel
FT                   region; SPTR: Guanylate kinase; TIGRFAM: guanylate kinase;
FT                   PFAM: Guanylate kinase; TIGRFAM: guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32908"
FT                   /db_xref="GOA:E4TXZ5"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ5"
FT                   /protein_id="ADR32908.1"
FT                   /translation="MNRQSGAILVLSGPSGAGKSSLIQKIKDQIGPIYFSISTTTRPIR
FT                   EGEVDGVHYYFVGVEEFKRDIEDEMFLEYAVVHGNYYGTSLGPVKKALKEGKLVIFDID
FT                   VQGHDAVQNRLSDITTSVFITTPSLEELKRRLYNRSTDSEEVILGRIEMAKREVQRISE
FT                   YDFLIVNDNLEEAAEILVSIAKAARMKIPTFQINEFVQTWEAS"
     MNRQSGAILV LSGPSGAGKS SLIQKIKDQI GPIYFSISTT TRPIREGEVD GVHYYFVGVE        60
     EFKRDIEDEM FLEYAVVHGN YYGTSLGPVK KALKEGKLVI FDIDVQGHDA VQNRLSDITT       120
     SVFITTPSLE ELKRRLYNRS TDSEEVILGR IEMAKREVQR ISEYDFLIVN DNLEEAAEIL       180
     VSIAKAARMK IPTFQINEFV QTWEAS                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page