(data stored in ACNUC7421 zone)

EMBL: CP002355.PE241

CP002355.PE241       Location/Qualifiers
FT   CDS             230637..230873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0242"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="InterPro IPR006312: IPR003369; KEGG: tdn:Suden_1795
FT                   twin-arginine translocation protein TatA/E; PFAM:
FT                   sec-independent translocation protein mttA/Hcf106; SPTR:
FT                   Twin-arginine translocation protein TatA/E; TIGRFAM:
FT                   twin-arginine translocation protein, TatA/E family subunit;
FT                   PFAM: mttA/Hcf106 family; TIGRFAM: twin arginine-targeting
FT                   protein translocase, TatA/E family"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32909"
FT                   /db_xref="GOA:E4TXZ6"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ6"
FT                   /protein_id="ADR32909.1"
FT                   /translation="MSMPSGTELLLIFGIVILLFGAKKIPDLAKGIGQGIRNFKKEMKE
FT                   EEPVATTTPTEAPKQVDASASTTAEAPKTTTQA"
     MSMPSGTELL LIFGIVILLF GAKKIPDLAK GIGQGIRNFK KEMKEEEPVA TTTPTEAPKQ        60
     VDASASTTAE APKTTTQA                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page