(data stored in ACNUC7421 zone)

EMBL: CP002355.PE242

CP002355.PE242       Location/Qualifiers
FT   CDS             230877..232457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0243"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COGs: COG0018 Arginyl-tRNA synthetase;
FT                   InterProIPR001412: IPR001278: IPR015945: IPR005148: IPR
FT                   008909; KEGG: tdn:Suden_1794 arginyl-tRNA synthetase; PFAM:
FT                   Arginyl-tRNA synthetase, class Ic, core; arginyl tRNA
FT                   synthetase domain protein; DALR anticodon binding domain
FT                   protein; PRIAM: Arginine--tRNA ligase; SPTR: Arginyl-tRNA
FT                   synthetase; TIGRFAM: arginyl-tRNA synthetase; PFAM: DALR
FT                   anticodon binding domain; Arginyl tRNA synthetase N
FT                   terminal domain; tRNA synthetases class I (R); TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32910"
FT                   /db_xref="GOA:E4TXZ7"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ7"
FT                   /protein_id="ADR32910.1"
FT                   /translation="MKQRVNALLRDKFNADVILEKPKDRSFGHFATPIAFSLAKELRKS
FT                   PMLIAEEIAGSFADESMFSAVESVQGYINFRLSEAFLDEYASWALSHGDEFGSSDKKGT
FT                   ILLEFVSANPTGPLHIGHARGAVYGDTMLRLGRHLGYDITAEYYVNDAGNQIDLLGVSL
FT                   QLEGRSSLLGESVEWPEKYYRGEYLSDLAREVVELFGEEALRDESRQKELALWAKDKIL
FT                   ALIVDDLAAINVHFDTFVGEASLYSEWDRVMAKMGEGVYVNEGKTFIRSSDLGDDHDRV
FT                   VVREDGRPTYLAGDIIYHNQKFERGYDDYINIWGADHHGYIARVKAAITFLGYDSSKLE
FT                   VLLSQMVSLLKDGEPFKMSKRAGTVILMSDVVEEIGAEALRFMFASKKCDTALEFDIEE
FT                   LKRQDSSNPIYYIQYAHARIQTLISKSEKNMDEIMGSHLYGLSSDADGLLFEALLLPEI
FT                   IDDAFESRQAQKLPDYLKVLAGRLHKFYYDTRIIGTEDEAKLLKLLLVVALSIKTGLSL
FT                   LGIQAKDRM"
     MKQRVNALLR DKFNADVILE KPKDRSFGHF ATPIAFSLAK ELRKSPMLIA EEIAGSFADE        60
     SMFSAVESVQ GYINFRLSEA FLDEYASWAL SHGDEFGSSD KKGTILLEFV SANPTGPLHI       120
     GHARGAVYGD TMLRLGRHLG YDITAEYYVN DAGNQIDLLG VSLQLEGRSS LLGESVEWPE       180
     KYYRGEYLSD LAREVVELFG EEALRDESRQ KELALWAKDK ILALIVDDLA AINVHFDTFV       240
     GEASLYSEWD RVMAKMGEGV YVNEGKTFIR SSDLGDDHDR VVVREDGRPT YLAGDIIYHN       300
     QKFERGYDDY INIWGADHHG YIARVKAAIT FLGYDSSKLE VLLSQMVSLL KDGEPFKMSK       360
     RAGTVILMSD VVEEIGAEAL RFMFASKKCD TALEFDIEEL KRQDSSNPIY YIQYAHARIQ       420
     TLISKSEKNM DEIMGSHLYG LSSDADGLLF EALLLPEIID DAFESRQAQK LPDYLKVLAG       480
     RLHKFYYDTR IIGTEDEAKL LKLLLVVALS IKTGLSLLGI QAKDRM                      526
//

If you have problems or comments...

PBIL Back to PBIL home page