(data stored in ACNUC7421 zone)

EMBL: CP002355.PE243

CP002355.PE243       Location/Qualifiers
FT   CDS             complement(232506..233252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0244"
FT                   /product="flagellin domain protein"
FT                   /note="InterPro IPR001492: IPR001029; KEGG:
FT                   cff:CFF8240_0520 flagellin; PFAM: flagellin domain protein;
FT                   SPTR: Flagellin; PFAM: Bacterial flagellin N-terminal
FT                   helical region; Bacterial flagellin C-terminal helical
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32911"
FT                   /db_xref="GOA:E4TXZ8"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:E4TXZ8"
FT                   /protein_id="ADR32911.1"
FT                   /translation="MKVNSLSNALPQMNTETSNRDKTLEKIATAVELKLEDSSSRTIAD
FT                   MMQNQISSLSQGLMNANDGIAMLQIADGALSSLSDQTQTLNDLSVRNNSAILNSADKQA
FT                   LNSQFQRTLSSMQNIVNTTSYNGNPLFNNNFSISIGEGTLSASIANVSPKGLSIDNQEG
FT                   INQYAQTLASAQSDVGSATNNFISSTNVLLQQITDTAAAKSQIADTDMAKQVSEFQQSN
FT                   NQISAGLLAMAHQTDTMRQSMARLLG"
     MKVNSLSNAL PQMNTETSNR DKTLEKIATA VELKLEDSSS RTIADMMQNQ ISSLSQGLMN        60
     ANDGIAMLQI ADGALSSLSD QTQTLNDLSV RNNSAILNSA DKQALNSQFQ RTLSSMQNIV       120
     NTTSYNGNPL FNNNFSISIG EGTLSASIAN VSPKGLSIDN QEGINQYAQT LASAQSDVGS       180
     ATNNFISSTN VLLQQITDTA AAKSQIADTD MAKQVSEFQQ SNNQISAGLL AMAHQTDTMR       240
     QSMARLLG                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page