(data stored in ACNUC7421 zone)

EMBL: CP002355.PE245

CP002355.PE245       Location/Qualifiers
FT   CDS             234248..234928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0246"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="COGs: COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain; InterPro IPR001789: IPR001867; KEGG: abu:Abu_1762
FT                   two-component response regulator; PFAM: response regulator
FT                   receiver; transcriptional regulator domain-containing
FT                   protein; SMART: response regulator receiver; SPTR:
FT                   Two-component response regulator; PFAM: Response regulator
FT                   receiver domain; Transcriptional regulatory protein, C
FT                   terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32913"
FT                   /db_xref="GOA:E4TY00"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY00"
FT                   /protein_id="ADR32913.1"
FT                   /translation="MEKSATKNLHVLYVEDDDVARENGIEYLENYFDHVHAASDAFEGL
FT                   KLYREVHPEIIITDIQMPKLNGLEFIKQIRKENKETQIIVISAYSDTTYLLQAIELQLV
FT                   KYLIKPVQESAFKEALRQCIESIHHKDSNIINLPENTYFDTYNQTLVRDGDIVALRTKE
FT                   LQILSLLLKYKNRYVTYSEIENHVWRESAMSNDALKTLMKNLKAKLPPNLISNLSGTGY
FT                   KIEC"
     MEKSATKNLH VLYVEDDDVA RENGIEYLEN YFDHVHAASD AFEGLKLYRE VHPEIIITDI        60
     QMPKLNGLEF IKQIRKENKE TQIIVISAYS DTTYLLQAIE LQLVKYLIKP VQESAFKEAL       120
     RQCIESIHHK DSNIINLPEN TYFDTYNQTL VRDGDIVALR TKELQILSLL LKYKNRYVTY       180
     SEIENHVWRE SAMSNDALKT LMKNLKAKLP PNLISNLSGT GYKIEC                      226
//

If you have problems or comments...

PBIL Back to PBIL home page