(data stored in ACNUC7421 zone)

EMBL: CP002355.PE246

CP002355.PE246       Location/Qualifiers
FT   CDS             234918..236237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0247"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="COGs: COG4191 Signal transduction histidine kinase
FT                   regulating C4-dicarboxylate transport system; InterPro
FT                   IPR004358: IPR005467: IPR003594; KEGG: abu:Abu_1761
FT                   two-component sensor histidine kinase; PFAM: ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; SPTR: Two-component sensor histidine
FT                   kinase; PFAM: 7TM diverse intracellular signalling;
FT                   Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32914"
FT                   /db_xref="GOA:E4TY01"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY01"
FT                   /protein_id="ADR32914.1"
FT                   /translation="MSAEAFTHLAYGATFGILLMSIVYTLVRYVYSKEIMYISYCAMQV
FT                   FSLGYISVYSHLFSLSAFSQEIFLLLATLSAVIFAITFHEGNLIPKITNFKELVINTLL
FT                   LNVVILTAFYHYILFEYLPYTVVYAILFLSIVFNLRSGFKPTIVYVIGWSLLCILLFVF
FT                   QLKQVYVEHGYIDIVLAAFAVEAVLFTISISYKYNLFKNQALDHQNMLFQQSKMAKSGE
FT                   MIANITHQFRQPLNNLSYLLMNLKSRYENRTLDDAYFDKKIASAQEQLQFLSKTIDDFK
FT                   EFYTPDKVKEPFSLTEAIRNSVAVIAPDLKSKGIVLEVVACDEEVIVFGKKNELSQVLL
FT                   ALISNASDALRGVSEPKIILRSNRNGSEAMIRLEDNGSGIPSDVLGKIFEPYVTTKSQG
FT                   SGIGLYLCKMIIEKSFGGKIEVESKVREGSVFTLSMALYH"
     MSAEAFTHLA YGATFGILLM SIVYTLVRYV YSKEIMYISY CAMQVFSLGY ISVYSHLFSL        60
     SAFSQEIFLL LATLSAVIFA ITFHEGNLIP KITNFKELVI NTLLLNVVIL TAFYHYILFE       120
     YLPYTVVYAI LFLSIVFNLR SGFKPTIVYV IGWSLLCILL FVFQLKQVYV EHGYIDIVLA       180
     AFAVEAVLFT ISISYKYNLF KNQALDHQNM LFQQSKMAKS GEMIANITHQ FRQPLNNLSY       240
     LLMNLKSRYE NRTLDDAYFD KKIASAQEQL QFLSKTIDDF KEFYTPDKVK EPFSLTEAIR       300
     NSVAVIAPDL KSKGIVLEVV ACDEEVIVFG KKNELSQVLL ALISNASDAL RGVSEPKIIL       360
     RSNRNGSEAM IRLEDNGSGI PSDVLGKIFE PYVTTKSQGS GIGLYLCKMI IEKSFGGKIE       420
     VESKVREGSV FTLSMALYH                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page