(data stored in ACNUC7421 zone)

EMBL: CP002355.PE248

CP002355.PE248       Location/Qualifiers
FT   CDS             237684..238472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0249"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="InterPro IPR001623; KEGG: tdn:Suden_1842 heat shock
FT                   protein DnaJ-like; PFAM: heat shock protein DnaJ domain
FT                   protein; SMART: heat shock protein DnaJ domain protein;
FT                   SPTR: DnaJ domain protein; PFAM: DnaJ domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32916"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY03"
FT                   /protein_id="ADR32916.1"
FT                   /translation="MKVVLRNNAIFVQGSSNTLEESWMEEFFDHHIHNTLFLDNGVLVL
FT                   NNENSSDQKEEFLETLSERFTKANELTSSFYSRSLKRCRTAAVRIEVPFRESEKVDIEV
FT                   YAYNSGCVQFTLLSPNRWVMRYLKQQLSNLVTSSTDDDIFIDVSTAAAKARLEKTLNRR
FT                   EVLHFTINYQYDDEFMSRLYGNYKGWGFGNDAIDKMIRYHAIFEIPMGSTPEDLKKRYR
FT                   MLAKRYHPDRVQSKNPKIINKYTEKFQLLQEAYGALRAVS"
     MKVVLRNNAI FVQGSSNTLE ESWMEEFFDH HIHNTLFLDN GVLVLNNENS SDQKEEFLET        60
     LSERFTKANE LTSSFYSRSL KRCRTAAVRI EVPFRESEKV DIEVYAYNSG CVQFTLLSPN       120
     RWVMRYLKQQ LSNLVTSSTD DDIFIDVSTA AAKARLEKTL NRREVLHFTI NYQYDDEFMS       180
     RLYGNYKGWG FGNDAIDKMI RYHAIFEIPM GSTPEDLKKR YRMLAKRYHP DRVQSKNPKI       240
     INKYTEKFQL LQEAYGALRA VS                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page