(data stored in ACNUC7421 zone)

EMBL: CP002355.PE250

CP002355.PE250       Location/Qualifiers
FT   CDS             complement(239415..239744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0251"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecb:100060083 similar to tetratricopeptide
FT                   repeat domain 6; SPTR: Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32918"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY05"
FT                   /protein_id="ADR32918.1"
FT                   /translation="MLNTIREAQKQFQLLHQLLNLPMNRDTEYFTQLSIESEEAYVLMN
FT                   AGMCINTSVCRECAEHRDFIRSILEILSELEINASAANTYAAKLNEYSERVSKILKNIA
FT                   VVLAS"
     MLNTIREAQK QFQLLHQLLN LPMNRDTEYF TQLSIESEEA YVLMNAGMCI NTSVCRECAE        60
     HRDFIRSILE ILSELEINAS AANTYAAKLN EYSERVSKIL KNIAVVLAS                   109
//

If you have problems or comments...

PBIL Back to PBIL home page