(data stored in ACNUC7421 zone)

EMBL: CP002355.PE255

CP002355.PE255       Location/Qualifiers
FT   CDS             243802..244035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tkm:TK90_2821 type IV secretory pathway VirB4
FT                   components-like protein; SPTR: Type IV secretory pathway
FT                   VirB4 components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32923"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY10"
FT                   /protein_id="ADR32923.1"
FT                   /translation="MLSVQINNPAVENFFHHSSESIVQFLEKAVAHLEKNPSFIVSSMD
FT                   DARARVESARKSDDTLSEEEYKSDMEAFWKSV"
     MLSVQINNPA VENFFHHSSE SIVQFLEKAV AHLEKNPSFI VSSMDDARAR VESARKSDDT        60
     LSEEEYKSDM EAFWKSV                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page