(data stored in ACNUC7421 zone)

EMBL: CP002355.PE256

CP002355.PE256       Location/Qualifiers
FT   CDS             244020..244316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0257"
FT                   /product="plasmid stabilization system"
FT                   /note="InterPro IPR007712; KEGG: tdn:Suden_0815 plasmid
FT                   stabilization system protein; PFAM: plasmid stabilization
FT                   system; SPTR: Plasmid stabilization system; PFAM: Plasmid
FT                   stabilisation system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32924"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY11"
FT                   /protein_id="ADR32924.1"
FT                   /translation="MEECVIRIVRNRKFTIQLQNILRFIALDKRSAALDFQHEIDTKFE
FT                   LLKTQPMMGRVSLYAEDENVRDLIYCGYTIVYEIKDEQTIRILEIFKWQDKLG"
     MEECVIRIVR NRKFTIQLQN ILRFIALDKR SAALDFQHEI DTKFELLKTQ PMMGRVSLYA        60
     EDENVRDLIY CGYTIVYEIK DEQTIRILEI FKWQDKLG                                98
//

If you have problems or comments...

PBIL Back to PBIL home page