(data stored in ACNUC7421 zone)

EMBL: CP002355.PE258

CP002355.PE258       Location/Qualifiers
FT   CDS             246152..247000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0259"
FT                   /product="Endonuclease IV"
FT                   /EC_number="3.1.21.-"
FT                   /note="COGs: COG0648 Endonuclease IV; InterPro IPR018246:
FT                   IPR001719: IPR012307; KEGG: tdn:Suden_1835 endonuclease IV;
FT                   PFAM: Xylose isomerase domain-containing protein TIM
FT                   barrel; PRIAM: Deoxyribonuclease IV (phage-T(4)-induced);
FT                   SMART: AP endonuclease family 2; SPTR: Probable
FT                   endonuclease 4; TIGRFAM: apurinic endonuclease Apn1; PFAM:
FT                   Xylose isomerase-like TIM barrel; TIGRFAM: apurinic
FT                   endonuclease (APN1)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32926"
FT                   /db_xref="GOA:E4TY13"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY13"
FT                   /protein_id="ADR32926.1"
FT                   /translation="MSNKYVGAHVSASGGVFNAPLNAMAIGAKAFALFTKNQKQWAAKP
FT                   LDDETIGLFKDNLAKSGILPKHVLPHDSYLINLGHPEEDKRQKSLEAFIDETRRCMQLG
FT                   LDRLNFHPGSHLKQISEEECIERIASSMNETLSVTNGVTLVIENTAGQGSNLGWRFEHL
FT                   SAIIERIEDKSRVGVCIDTCHMFTAGYDIRTRAAYDATWKEFDTIVGFKYLKGMHINDS
FT                   KPDLGSHVDRHDSIGKGKIGVEPFGFIMNDPRMDDIPLVLETIDETIWAQEIALLYSLQ
FT                   R"
     MSNKYVGAHV SASGGVFNAP LNAMAIGAKA FALFTKNQKQ WAAKPLDDET IGLFKDNLAK        60
     SGILPKHVLP HDSYLINLGH PEEDKRQKSL EAFIDETRRC MQLGLDRLNF HPGSHLKQIS       120
     EEECIERIAS SMNETLSVTN GVTLVIENTA GQGSNLGWRF EHLSAIIERI EDKSRVGVCI       180
     DTCHMFTAGY DIRTRAAYDA TWKEFDTIVG FKYLKGMHIN DSKPDLGSHV DRHDSIGKGK       240
     IGVEPFGFIM NDPRMDDIPL VLETIDETIW AQEIALLYSL QR                          282
//

If you have problems or comments...

PBIL Back to PBIL home page