(data stored in ACNUC7421 zone)

EMBL: CP002355.PE259

CP002355.PE259       Location/Qualifiers
FT   CDS             247004..248215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0260"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="COGs: COG2067 Long-chain fatty acid transport
FT                   protein; InterPro IPR005017; KEGG: tdn:Suden_1834
FT                   hypothetical protein; PFAM: membrane protein involved in
FT                   aromatic hydrocarbon degradation; SPTR: Membrane protein;
FT                   PFAM: Outer membrane protein transport protein
FT                   (OMPP1/FadL/TodX)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32927"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY14"
FT                   /protein_id="ADR32927.1"
FT                   /translation="MKRSLVLSVALSAALSAAGYKIPENSINATALSAAYVANVHGADA
FT                   AYYNPAAMVYNDDANLLEVDATYIGLSGIDFSGSTGNYSSKKEDFLVPTLHFSSKKLGD
FT                   SGARVGFSIVAPAGLSKRWDYPAAKASAKEFTLKTIEVNPSFAVPISDSVSFGAGLRIV
FT                   RSDGVVKSDTGTPSYISRNLEGDSIDIGYNIALVYKPLKELSLAATYRSKVNLTVEGEA
FT                   DLNYLPSIHPAHAAYSGSASVAVPIPAALNLAAAYTFDTGTTIEAVFERTYWSAYKTLD
FT                   FDYDGTMNAATVAFGTPIAKNWEDTNTYRLGITQKIDQWTAMAGLAYDQTPVPEATLGY
FT                   ELPDADALIVSLGGRYKMDEHWDIGLAGLIDMKKDRSVHNSSINGEFTNARAYLVTAGI
FT                   GYRF"
     MKRSLVLSVA LSAALSAAGY KIPENSINAT ALSAAYVANV HGADAAYYNP AAMVYNDDAN        60
     LLEVDATYIG LSGIDFSGST GNYSSKKEDF LVPTLHFSSK KLGDSGARVG FSIVAPAGLS       120
     KRWDYPAAKA SAKEFTLKTI EVNPSFAVPI SDSVSFGAGL RIVRSDGVVK SDTGTPSYIS       180
     RNLEGDSIDI GYNIALVYKP LKELSLAATY RSKVNLTVEG EADLNYLPSI HPAHAAYSGS       240
     ASVAVPIPAA LNLAAAYTFD TGTTIEAVFE RTYWSAYKTL DFDYDGTMNA ATVAFGTPIA       300
     KNWEDTNTYR LGITQKIDQW TAMAGLAYDQ TPVPEATLGY ELPDADALIV SLGGRYKMDE       360
     HWDIGLAGLI DMKKDRSVHN SSINGEFTNA RAYLVTAGIG YRF                         403
//

If you have problems or comments...

PBIL Back to PBIL home page