(data stored in ACNUC7421 zone)

EMBL: CP002355.PE26

CP002355.PE26        Location/Qualifiers
FT   CDS             complement(28258..28749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0026"
FT                   /product="adenosylcobinamide kinase"
FT                   /EC_number="2.7.1.156"
FT                   /note="COGs: COG2087 Adenosyl cobinamide kinase/adenosyl
FT                   cobinamide phosphate guanylyltransferase; InterPro
FT                   IPR003203; KEGG: ant:Arnit_1838 cobalbumin biosynthesis
FT                   protein; PFAM: cobalbumin biosynthesis protein; SPTR:
FT                   Cobalbumin biosynthesis protein; PFAM: Cobinamide kinase /
FT                   cobinamide phosphate guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32694"
FT                   /db_xref="GOA:E4TW78"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW78"
FT                   /protein_id="ADR32694.1"
FT                   /translation="MKILYFGGQKSGKSSLAEAKTLAIATDKPYYLATYDHTFGDEEMG
FT                   ARIDKHRISRGEEFITLEESRDLSRVIEPHHTYLVDCISMWILNRLDENEEVLVAEIEA
FT                   LGAIDANIVFVLNDVTSGVIPSDPISRRYVDLSGIIGQRLARLCDEVVEVKLGLERRLK
FT                   "
     MKILYFGGQK SGKSSLAEAK TLAIATDKPY YLATYDHTFG DEEMGARIDK HRISRGEEFI        60
     TLEESRDLSR VIEPHHTYLV DCISMWILNR LDENEEVLVA EIEALGAIDA NIVFVLNDVT       120
     SGVIPSDPIS RRYVDLSGII GQRLARLCDE VVEVKLGLER RLK                         163
//

If you have problems or comments...

PBIL Back to PBIL home page