(data stored in ACNUC7421 zone)

EMBL: CP002355.PE260

CP002355.PE260       Location/Qualifiers
FT   CDS             248212..249756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0261"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="COGs: COG0318 Acyl-CoA synthetase
FT                   (AMP-forming)/AMP-acid ligase II; InterPro IPR020845:
FT                   IPR000873; KEGG: wsu:WS0237 long-chain-fatty-acid--CoA
FT                   ligase; PFAM: AMP-dependent synthetase and ligase; SPTR:
FT                   Serine O-acetyltransferase; PFAM: AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32928"
FT                   /db_xref="GOA:E4TY15"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY15"
FT                   /protein_id="ADR32928.1"
FT                   /translation="MIHYPYENFYAMLYGVAKENPRKNVIFIDNERYSYQRFLENVDRT
FT                   ARALEVIGVGRGDKIALICPNSVEFVQSIFAISKLGAISVPINTMLKNEEYRYILGDCG
FT                   AKAVITAFKLAQEVRGLRDDVASIEHTIWIDKAPFEDAKHLLLGEMVADHVHHHSPSPA
FT                   KLDDTAVIFYTSGTTGHPKGAMISNRNLFSNLVAAQERFDLSPKDRFIVYLPMFHSFTF
FT                   AIMVILPFFMRASFVIIPSILPFSNIVRQTLLKRVTIFMGVPDIYNALIRARLPWYFLW
FT                   FNSVRCFISGGSALSEDTLTRFRSLFKRAVMLEGYGLSECSPAVAVNLLEKQKTLSVGL
FT                   PLYGYEVKIVNDEMEELPCGEAGELIVRGECVMQGYLNNPTATAETIQNGWLRTGDIAK
FT                   IDEEGYIYIVDRIKDLIISKGINIYPRQIEEHLMLLPHIKLAAVIGVSDPHSGEVPIAF
FT                   VELEEGYETTTPAFIKAQLKEHLALFKIPKTITVVESLPKTATGKVLKRVLKQGNY"
     MIHYPYENFY AMLYGVAKEN PRKNVIFIDN ERYSYQRFLE NVDRTARALE VIGVGRGDKI        60
     ALICPNSVEF VQSIFAISKL GAISVPINTM LKNEEYRYIL GDCGAKAVIT AFKLAQEVRG       120
     LRDDVASIEH TIWIDKAPFE DAKHLLLGEM VADHVHHHSP SPAKLDDTAV IFYTSGTTGH       180
     PKGAMISNRN LFSNLVAAQE RFDLSPKDRF IVYLPMFHSF TFAIMVILPF FMRASFVIIP       240
     SILPFSNIVR QTLLKRVTIF MGVPDIYNAL IRARLPWYFL WFNSVRCFIS GGSALSEDTL       300
     TRFRSLFKRA VMLEGYGLSE CSPAVAVNLL EKQKTLSVGL PLYGYEVKIV NDEMEELPCG       360
     EAGELIVRGE CVMQGYLNNP TATAETIQNG WLRTGDIAKI DEEGYIYIVD RIKDLIISKG       420
     INIYPRQIEE HLMLLPHIKL AAVIGVSDPH SGEVPIAFVE LEEGYETTTP AFIKAQLKEH       480
     LALFKIPKTI TVVESLPKTA TGKVLKRVLK QGNY                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page