(data stored in ACNUC7421 zone)

EMBL: CP002355.PE261

CP002355.PE261       Location/Qualifiers
FT   CDS             249753..251489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0262"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="COGs: COG0464 ATPase of the AAA+ class; InterPro
FT                   IPR003959: IPR003593; KEGG: tdn:Suden_1833 AAA ATPase;
FT                   PFAM: AAA ATPase central domain protein; SMART: AAA ATPase;
FT                   SPTR: AAA ATPase; PFAM: ATPase family associated with
FT                   various cellular activities (AAA)"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32929"
FT                   /db_xref="GOA:E4TY16"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY16"
FT                   /protein_id="ADR32929.1"
FT                   /translation="MKYLIDFLENKIIEETHIFSQLKCTVEEAKILQLLTRKFLQSQED
FT                   VIVAELLQELYGSDDYSYLGHFGEVKTLLELGWITHHSFTPLKISELSHLELYNTPVAV
FT                   TSVFMKLLEEGSLEMTLPDIKPYADHLEYLQDQFFRIELYQKMSIIRHSGNEHSLGINR
FT                   IQNKLDLLEKRIDERIAQTSLDVVLDRFFKQKKLEPKEQVIFLALLKEEYSATEGNLRE
FT                   MNTLIDLISFDDYERIKNRALLEDGSRLINEEVIDYEEMLNPFGGISRAFYIVDEVLQS
FT                   IMHPQKKKKVRKLKLDMLIKEQEIFELIEPTTSLENVVLNPSTEQTLSNLMRQLDREVI
FT                   ARLHEWGVKDKKAGIDARIIFYGPPGTGKTLTAHSLSRSLKRQVLSFDCSKILSMYVGE
FT                   SEKNVRKIFDTYADLTRQTKTEPILLLNEADQFLSARSAGIGSSADQMHNQMQNIFLEQ
FT                   IEKFQGILIATTNLLENIDQAFSRRFNYKIEFKKPDQKQRVTLWNMMLPKNAPYEKGFN
FT                   VEKLASYPLTGGQINLIVKNTAYQVAARSEGTFRLEDFIAEIQKERSGSFEGEKSMGFI
FT                   NR"
     MKYLIDFLEN KIIEETHIFS QLKCTVEEAK ILQLLTRKFL QSQEDVIVAE LLQELYGSDD        60
     YSYLGHFGEV KTLLELGWIT HHSFTPLKIS ELSHLELYNT PVAVTSVFMK LLEEGSLEMT       120
     LPDIKPYADH LEYLQDQFFR IELYQKMSII RHSGNEHSLG INRIQNKLDL LEKRIDERIA       180
     QTSLDVVLDR FFKQKKLEPK EQVIFLALLK EEYSATEGNL REMNTLIDLI SFDDYERIKN       240
     RALLEDGSRL INEEVIDYEE MLNPFGGISR AFYIVDEVLQ SIMHPQKKKK VRKLKLDMLI       300
     KEQEIFELIE PTTSLENVVL NPSTEQTLSN LMRQLDREVI ARLHEWGVKD KKAGIDARII       360
     FYGPPGTGKT LTAHSLSRSL KRQVLSFDCS KILSMYVGES EKNVRKIFDT YADLTRQTKT       420
     EPILLLNEAD QFLSARSAGI GSSADQMHNQ MQNIFLEQIE KFQGILIATT NLLENIDQAF       480
     SRRFNYKIEF KKPDQKQRVT LWNMMLPKNA PYEKGFNVEK LASYPLTGGQ INLIVKNTAY       540
     QVAARSEGTF RLEDFIAEIQ KERSGSFEGE KSMGFINR                               578
//

If you have problems or comments...

PBIL Back to PBIL home page