(data stored in ACNUC7421 zone)

EMBL: CP002355.PE262

CP002355.PE262       Location/Qualifiers
FT   CDS             251606..252700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0263"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
FT                   InterPro IPR004090: IPR004089; KEGG: cla:Cla_1032
FT                   MCP-domain signal transduction protein; PFAM: chemotaxis
FT                   sensory transducer; SMART: chemotaxis sensory transducer;
FT                   SPTR: Methyl-accepting chemotaxis protein; PFAM:
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain;
FT                   Myosin-like coiled-coil protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32930"
FT                   /db_xref="GOA:E4TY17"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY17"
FT                   /protein_id="ADR32930.1"
FT                   /translation="MGWFSDDTELKEELSVLQKENTALRDENQELARKLQECEAKIAKE
FT                   DERHRCENASMIMTYQNEQLKKNLVDVQGNMASSVASSKENIAQSTALLENIVELGQKA
FT                   SGISHTLEGLNHLALESMDTVKALSDRAQDVASILVLIKDISDQTNLLALNAAIEAARA
FT                   GEHGRGFAVVADEVRKLADRTDKAISEINISLQSMKQDVTTIGEKFDQVQESIADSNES
FT                   IGSFNANMDHNAQMMRETFASTEHTAERIFMSLAKLDHIVWKVNTYLSAITRKEQFNFV
FT                   DHHNCRLGKWYYEGEGADFFKKTPSYSALETPHSVVHNSTHKIFDLMKTESVGSERFVK
FT                   VFEEMEHASDGVFATLDRMLQEKN"
     MGWFSDDTEL KEELSVLQKE NTALRDENQE LARKLQECEA KIAKEDERHR CENASMIMTY        60
     QNEQLKKNLV DVQGNMASSV ASSKENIAQS TALLENIVEL GQKASGISHT LEGLNHLALE       120
     SMDTVKALSD RAQDVASILV LIKDISDQTN LLALNAAIEA ARAGEHGRGF AVVADEVRKL       180
     ADRTDKAISE INISLQSMKQ DVTTIGEKFD QVQESIADSN ESIGSFNANM DHNAQMMRET       240
     FASTEHTAER IFMSLAKLDH IVWKVNTYLS AITRKEQFNF VDHHNCRLGK WYYEGEGADF       300
     FKKTPSYSAL ETPHSVVHNS THKIFDLMKT ESVGSERFVK VFEEMEHASD GVFATLDRML       360
     QEKN                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page