(data stored in ACNUC7421 zone)

EMBL: CP002355.PE263

CP002355.PE263       Location/Qualifiers
FT   CDS             253017..253406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0264"
FT                   /product="NADH dehydrogenase subunit A"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0838 NADH:ubiquinone oxidoreductase subunit
FT                   3 (chain A); InterPro IPR000440; KEGG: tdn:Suden_1829 NADH
FT                   dehydrogenase subunit A; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase chain 3; SPTR:
FT                   NADH-quinone oxidoreductase subunit; PFAM:
FT                   NADH-ubiquinone/plastoquinone oxidoreductase, chain 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32931"
FT                   /db_xref="GOA:E4TY18"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY18"
FT                   /protein_id="ADR32931.1"
FT                   /translation="MEHYNTANPYFGVFVLFVLTFGAFYATTVIARLASRALAAKDTEK
FT                   LKMTVYECGPEVTKQPNRISTQFYLFALLFLLFDVEIVFMFPWAIDFKLLGWFGFVEMM
FT                   MFILLLAIGFVYAWKKGALEWHNIK"
     MEHYNTANPY FGVFVLFVLT FGAFYATTVI ARLASRALAA KDTEKLKMTV YECGPEVTKQ        60
     PNRISTQFYL FALLFLLFDV EIVFMFPWAI DFKLLGWFGF VEMMMFILLL AIGFVYAWKK       120
     GALEWHNIK                                                               129
//

If you have problems or comments...

PBIL Back to PBIL home page