(data stored in ACNUC7421 zone)

EMBL: CP002355.PE264

CP002355.PE264       Location/Qualifiers
FT   CDS             253388..253897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0265"
FT                   /product="NADH dehydrogenase subunit B"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0377 NADH:ubiquinone oxidoreductase 20 kD
FT                   subunit and related Fe-S oxidoreductase; InterPro
FT                   IPR006138: IPR006137; KEGG: tdn:Suden_1828 NADH
FT                   dehydrogenase subunit B; PFAM: NADH ubiquinone
FT                   oxidoreductase 20 kDa subunit; PRIAM: NADH dehydrogenase
FT                   (quinone); SPTR: NADH dehydrogenase i chain b; TIGRFAM:
FT                   NADH-quinone oxidoreductase, B subunit; PFAM: NADH
FT                   ubiquinone oxidoreductase, 20 Kd subunit; TIGRFAM:
FT                   NADH-quinone oxidoreductase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32932"
FT                   /db_xref="GOA:E4TY19"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY19"
FT                   /protein_id="ADR32932.1"
FT                   /translation="MAQHQVNYLKDGGLPVALTTIDKVVNWGRSNSLWALTYGLACCGI
FT                   EMMASGASRYDFDRFGTIFRASPRQAELMVVAGTLTKKHAEFIRRLYDQMTEPKWVISM
FT                   GSCANTGGMFNTYATVQGVDRVIPVDLYLPGCAPRPETLQYAVLLLQQKIRRESASRAQ
FT                   KPKRLM"
     MAQHQVNYLK DGGLPVALTT IDKVVNWGRS NSLWALTYGL ACCGIEMMAS GASRYDFDRF        60
     GTIFRASPRQ AELMVVAGTL TKKHAEFIRR LYDQMTEPKW VISMGSCANT GGMFNTYATV       120
     QGVDRVIPVD LYLPGCAPRP ETLQYAVLLL QQKIRRESAS RAQKPKRLM                   169
//

If you have problems or comments...

PBIL Back to PBIL home page