(data stored in ACNUC7421 zone)

EMBL: CP002355.PE265

CP002355.PE265       Location/Qualifiers
FT   CDS             253897..254703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0266"
FT                   /product="NADH dehydrogenase subunit C"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0852 NADH:ubiquinone oxidoreductase 27 kD
FT                   subunit; InterPro IPR020396: IPR010218: IPR001268; KEGG:
FT                   tdn:Suden_1827 NADH dehydrogenase subunit C; PFAM: NADH
FT                   dehydrogenase (ubiquinone) 30 kDa subunit; SPTR:
FT                   NADH-quinone oxidoreductase; TIGRFAM: NADH (or F420H2)
FT                   dehydrogenase, subunit C; PFAM: Respiratory-chain NADH
FT                   dehydrogenase, 30 Kd subunit; TIGRFAM: NADH (or F420H2)
FT                   dehydrogenase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32933"
FT                   /db_xref="GOA:E4TY20"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY20"
FT                   /protein_id="ADR32933.1"
FT                   /translation="MRAYTPKDDVQKKPYYTDRYWVAPQVAKIDVSEDEVFAHDLEAIK
FT                   ASFDVLDAYIQVGQMVVIINAADNYGVIEMMKNELGYNQLSELSAIDWLAQEGKFEIFY
FT                   QMLSMNKRKRVRIKCKIDEKESIQSVSSLFRSADWSEREMYDMFGVVINNHPYMKRILM
FT                   PDDWEGFPLRKTYPLQGDEFAQWYEVDKLFGKEARDIIGPEIRDSARVDRYDTERFARL
FT                   GHEVPRGSDISQGEPDTPLCYQESDGVFLIEKFDAEKSVVISDRDR"
     MRAYTPKDDV QKKPYYTDRY WVAPQVAKID VSEDEVFAHD LEAIKASFDV LDAYIQVGQM        60
     VVIINAADNY GVIEMMKNEL GYNQLSELSA IDWLAQEGKF EIFYQMLSMN KRKRVRIKCK       120
     IDEKESIQSV SSLFRSADWS EREMYDMFGV VINNHPYMKR ILMPDDWEGF PLRKTYPLQG       180
     DEFAQWYEVD KLFGKEARDI IGPEIRDSAR VDRYDTERFA RLGHEVPRGS DISQGEPDTP       240
     LCYQESDGVF LIEKFDAEKS VVISDRDR                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page