(data stored in ACNUC7421 zone)

EMBL: CP002355.PE266

CP002355.PE266       Location/Qualifiers
FT   CDS             254713..255939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0267"
FT                   /product="NADH dehydrogenase subunit D"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG0649 NADH:ubiquinone oxidoreductase 49 kD
FT                   subunit 7; InterPro IPR010219: IPR001135; KEGG:
FT                   tdn:Suden_1826 NADH dehydrogenase subunit D; PFAM:
FT                   NADH-ubiquinone oxidoreductase chain 49kDa; PRIAM: NADH
FT                   dehydrogenase (quinone); SPTR: NADH-quinone oxidoreductase
FT                   subunit D; TIGRFAM: NADH dehydrogenase I, D subunit; PFAM:
FT                   Respiratory-chain NADH dehydrogenase, 49 Kd subunit;
FT                   TIGRFAM: NADH dehydrogenase I, D subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32934"
FT                   /db_xref="GOA:E4TY21"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:E4TY21"
FT                   /protein_id="ADR32934.1"
FT                   /translation="MQQSNRLRPFFENITFDRADNELILNFGPQHPSAHGQLRLMLHLQ
FT                   QEQITKAHPDIGYLHRGMEKMAENMIYNEFMPTTDRMDYIASSSNNYGFALAVERLIGL
FT                   DVPRRAKVIRMMLLETNRLMSHLFWLATTALDIGAMTVFLFAFREREYLMDLIEDYCGA
FT                   RLTHAAVRIGGVPLDLPDNFIPDLRKFLDKLPENIKDYEDLLDTNRIWKMRMENVGVIS
FT                   KEMAQSWGCSGIMLRASGVEWDIRKEEPYELYDEVDFNVPVSDKGDNYARYKLYMAEMR
FT                   ESAKILYQVLDMYEGTGPELMAHAPQYISAPKIDIMTQNYSLMQHFVLVTQGMRPPVGE
FT                   VYVATESPKGELGYFINSQGGAYPYRLKLRAPSFWHTGILTDLLPGHYIPDVVSIIGTT
FT                   NIVFGEVDR"
     MQQSNRLRPF FENITFDRAD NELILNFGPQ HPSAHGQLRL MLHLQQEQIT KAHPDIGYLH        60
     RGMEKMAENM IYNEFMPTTD RMDYIASSSN NYGFALAVER LIGLDVPRRA KVIRMMLLET       120
     NRLMSHLFWL ATTALDIGAM TVFLFAFRER EYLMDLIEDY CGARLTHAAV RIGGVPLDLP       180
     DNFIPDLRKF LDKLPENIKD YEDLLDTNRI WKMRMENVGV ISKEMAQSWG CSGIMLRASG       240
     VEWDIRKEEP YELYDEVDFN VPVSDKGDNY ARYKLYMAEM RESAKILYQV LDMYEGTGPE       300
     LMAHAPQYIS APKIDIMTQN YSLMQHFVLV TQGMRPPVGE VYVATESPKG ELGYFINSQG       360
     GAYPYRLKLR APSFWHTGIL TDLLPGHYIP DVVSIIGTTN IVFGEVDR                    408
//

If you have problems or comments...

PBIL Back to PBIL home page