(data stored in ACNUC7421 zone)

EMBL: CP002355.PE269

CP002355.PE269       Location/Qualifiers
FT   CDS             258233..260488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0270"
FT                   /product="NADH dehydrogenase subunit G"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1034 NADH dehydrogenase/NADH:ubiquinone
FT                   oxidoreductase 75 kD subunit (chain G); InterProIPR017900:
FT                   IPR019825: IPR000283: IPR001041: IPR 017896: IPR019574:
FT                   IPR006963; KEGG: tdn:Suden_1823 NADH dehydrogenase subunit
FT                   G; PFAM: NADH:ubiquinone oxidoreductase, subunit G,
FT                   iron-sulphur binding; ferredoxin; molybdopterin
FT                   oxidoreductase Fe4S4 region; SPTR: Ferredoxin; PFAM:
FT                   Molybdopterin oxidoreductase; NADH-ubiquinone
FT                   oxidoreductase-G iron-sulfur binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32937"
FT                   /db_xref="GOA:E4TYG0"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG0"
FT                   /protein_id="ADR32937.1"
FT                   /translation="MINFTINGQPVIANKGETILQAARKAGFYIPTMCYLEKTTPCASC
FT                   RLCVVETDKTDGLILSCQTPPTEGLAVVIDSDRLKTERTNIMRLYDVNHPLECGVCDKS
FT                   GACDLQNKTLEFGVSSQHFSAKDQHRKIEHWGLINYDPSLCILCEKCVHVCNEIIGDDA
FT                   IELQFGGYKSSVIPKNSDALDCTFCGECIAVCPVGALVSSNFQYSANAWELSQIPATCV
FT                   HCSAGCSLMYEVRHTSNLTGAKDKIYRVTNDFEHTTLCGAGRFGFDFNVEGTKDEAQFA
FT                   KAVDAIKNADAIRFSSLITNEEAMILQSLKEKLGLKLYNEEARAYQNFMNAYASISGKT
FT                   GFGGSLDAIKQSDGIIVFGGRVTTDNPMVRYAMTTAARHNGAKVVYMHPIEDDLLQNVV
FT                   TQYVKYEVGTEEGVVAMLAKTLLENADVSDETRHFFEGLDEGYLCAESNIGDEEYARMA
FT                   KTFARAKRKTLVIGSDVLTHKRAANISRLCAMIETYTEFSVVVIAPSVNTIGVSLICDL
FT                   DADNNGENVVGYNAAGSYTMGSFDEAMLKLPSLNSQEGTFVSINHQVLPTNVAVAFDGY
FT                   TLNDLANALGLSAHNTIDYTAQLPESKGFNGSSFDDLGNFYSALGEDNRGYVLENRDVE
FT                   ADGKLEEIDDLPEFNGTVVYRCNPVNQFNTYTARTEQLEKEAILRGSAQFAAAAKIGDG
FT                   DKIRIEFPHSTQERIFKLDSAMKGTIALVPAYDVGFGGLNEQYRFEKVKIMRMGSES"
     MINFTINGQP VIANKGETIL QAARKAGFYI PTMCYLEKTT PCASCRLCVV ETDKTDGLIL        60
     SCQTPPTEGL AVVIDSDRLK TERTNIMRLY DVNHPLECGV CDKSGACDLQ NKTLEFGVSS       120
     QHFSAKDQHR KIEHWGLINY DPSLCILCEK CVHVCNEIIG DDAIELQFGG YKSSVIPKNS       180
     DALDCTFCGE CIAVCPVGAL VSSNFQYSAN AWELSQIPAT CVHCSAGCSL MYEVRHTSNL       240
     TGAKDKIYRV TNDFEHTTLC GAGRFGFDFN VEGTKDEAQF AKAVDAIKNA DAIRFSSLIT       300
     NEEAMILQSL KEKLGLKLYN EEARAYQNFM NAYASISGKT GFGGSLDAIK QSDGIIVFGG       360
     RVTTDNPMVR YAMTTAARHN GAKVVYMHPI EDDLLQNVVT QYVKYEVGTE EGVVAMLAKT       420
     LLENADVSDE TRHFFEGLDE GYLCAESNIG DEEYARMAKT FARAKRKTLV IGSDVLTHKR       480
     AANISRLCAM IETYTEFSVV VIAPSVNTIG VSLICDLDAD NNGENVVGYN AAGSYTMGSF       540
     DEAMLKLPSL NSQEGTFVSI NHQVLPTNVA VAFDGYTLND LANALGLSAH NTIDYTAQLP       600
     ESKGFNGSSF DDLGNFYSAL GEDNRGYVLE NRDVEADGKL EEIDDLPEFN GTVVYRCNPV       660
     NQFNTYTART EQLEKEAILR GSAQFAAAAK IGDGDKIRIE FPHSTQERIF KLDSAMKGTI       720
     ALVPAYDVGF GGLNEQYRFE KVKIMRMGSE S                                      751
//

If you have problems or comments...

PBIL Back to PBIL home page