(data stored in ACNUC7421 zone)

EMBL: CP002355.PE27

CP002355.PE27        Location/Qualifiers
FT   CDS             complement(28746..29807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0027"
FT                   /product="Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /note="COGs: COG2038 NaMN:DMB phosphoribosyltransferase;
FT                   InterPro IPR002805: IPR003200; KEGG: ant:Arnit_1840
FT                   hypothetical protein; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; SPTR: Putative uncharacterized
FT                   protein; PFAM: Phosphoribosyltransferase; TIGRFAM:
FT                   conserved hypothetical protein TIGR00303"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32695"
FT                   /db_xref="GOA:E4TW79"
FT                   /db_xref="InterPro:IPR002805"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:E4TW79"
FT                   /protein_id="ADR32695.1"
FT                   /translation="MIKTITGNKDFIESLRGKRASFLLCMSNTKTANIEGITQAGIPGM
FT                   LHLTPTLDAEFIAIGEVRSLGSIAETPKGVPTPALLTRAVHLLHPFREIEMLELGLEIS
FT                   PKLEHFKLHSFGIAPSDSISDGANIPAEEVFEKGIQFAQNLTIQSDYIILGESVPAGTT
FT                   TALATALALGYDAQDKFSSSFKNAPSGIKQSVVDQALSRIGENDDLFSILSKVGDNMLI
FT                   FNAGLILGLQNRDIRIVLAGGTQMACALLVVNRILQMMEGELDTSRIALCTTKWVAEDT
FT                   QSDIKALLEMNDFALNAYYADFDFSLTDHPALKLYDEGEAKEGVGAGGALMYGLLNGLS
FT                   KEAITRKVESFLG"
     MIKTITGNKD FIESLRGKRA SFLLCMSNTK TANIEGITQA GIPGMLHLTP TLDAEFIAIG        60
     EVRSLGSIAE TPKGVPTPAL LTRAVHLLHP FREIEMLELG LEISPKLEHF KLHSFGIAPS       120
     DSISDGANIP AEEVFEKGIQ FAQNLTIQSD YIILGESVPA GTTTALATAL ALGYDAQDKF       180
     SSSFKNAPSG IKQSVVDQAL SRIGENDDLF SILSKVGDNM LIFNAGLILG LQNRDIRIVL       240
     AGGTQMACAL LVVNRILQMM EGELDTSRIA LCTTKWVAED TQSDIKALLE MNDFALNAYY       300
     ADFDFSLTDH PALKLYDEGE AKEGVGAGGA LMYGLLNGLS KEAITRKVES FLG              353
//

If you have problems or comments...

PBIL Back to PBIL home page