(data stored in ACNUC7421 zone)

EMBL: CP002355.PE270

CP002355.PE270       Location/Qualifiers
FT   CDS             260485..262971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0271"
FT                   /product="NADH dehydrogenase subunit G"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1034 NADH dehydrogenase/NADH:ubiquinone
FT                   oxidoreductase 75 kD subunit (chain G); InterProIPR017900:
FT                   IPR006655: IPR001041: IPR017896: IPR 019574: IPR006963;
FT                   KEGG: tdn:Suden_1822 NADH dehydrogenase subunit G; PFAM:
FT                   NADH:ubiquinone oxidoreductase, subunit G, iron-sulphur
FT                   binding; ferredoxin; molybdopterin oxidoreductase Fe4S4
FT                   region; SPTR: Ferredoxin; PFAM: NADH-ubiquinone
FT                   oxidoreductase-G iron-sulfur binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32938"
FT                   /db_xref="GOA:E4TYG1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG1"
FT                   /protein_id="ADR32938.1"
FT                   /translation="MNEITITIDGRTVQTQEGEYILNAARANGIFIPAICYLTRCSPTL
FT                   ACRICLVEADGKQVYACNAKAKEGMEITTTTPNILEERRAIMEVYDVNHPLECGVCDQS
FT                   GECELQNYTLEVGVDSQNYAIKDTHKPAQDWGLIHYDPALCIMCERCITVCKDMIGDAA
FT                   LSTVARGSDAIHGEYKAMMPKDAYAMWNKLNKSLIAPNGGDTLDCTNCGECTSVCPVGA
FT                   LVSSDYQYTSNAWEHKQIPATCAHCSAGCQLSYDIKHTSISNPESKIYRVKNEWNYVSL
FT                   CGAGRYGYDFENRDVSKDKAAFDKAIEAFKKADTIAFTSTITNEEAMILQRLKEKYGYR
FT                   LVNSEALALKNFLGSYSAISKTSLYGGDLKQVHEADFVVSIGSALKTDNPNARFAMNNA
FT                   LSMNKGSGLYFHPINDPVIQDMSKNITQFNHAPMMEEAALYLMLDLFGDKAAMPSAVTE
FT                   YLAGFHSTKTVTIEESVDEKVTETVTKKVLNEETGVEEEVSEEVTKTIKKKVSKEVEVD
FT                   DNALFGLLNAPEKFAETLEKYLAKKEKFALMVGPDLYTHPNAANCARLVALIEKYTPFS
FT                   VTMIPNLANTLGAALICDLDSSRGSYTIGYNTRGDFTLSALGNGDLDMPALNQQEGTLT
FT                   GIDKRVNPTNAALGYGGYVLNDIANALGITAKYTVDYTAQLPVKNGFKALSFDTLPNYY
FT                   TNAGEEVRGYVLENIAVNSGGDESVQPLNPNAAIRENVVYLANPVLQFSAFTAASHQLN
FT                   AKGGLYASHTAMQTNGWSEGDALRVKTAHGELSVNVIADGKIGGDITYLPTFDTAINSE
FT                   ALFDGYRFACVSIQKV"
     MNEITITIDG RTVQTQEGEY ILNAARANGI FIPAICYLTR CSPTLACRIC LVEADGKQVY        60
     ACNAKAKEGM EITTTTPNIL EERRAIMEVY DVNHPLECGV CDQSGECELQ NYTLEVGVDS       120
     QNYAIKDTHK PAQDWGLIHY DPALCIMCER CITVCKDMIG DAALSTVARG SDAIHGEYKA       180
     MMPKDAYAMW NKLNKSLIAP NGGDTLDCTN CGECTSVCPV GALVSSDYQY TSNAWEHKQI       240
     PATCAHCSAG CQLSYDIKHT SISNPESKIY RVKNEWNYVS LCGAGRYGYD FENRDVSKDK       300
     AAFDKAIEAF KKADTIAFTS TITNEEAMIL QRLKEKYGYR LVNSEALALK NFLGSYSAIS       360
     KTSLYGGDLK QVHEADFVVS IGSALKTDNP NARFAMNNAL SMNKGSGLYF HPINDPVIQD       420
     MSKNITQFNH APMMEEAALY LMLDLFGDKA AMPSAVTEYL AGFHSTKTVT IEESVDEKVT       480
     ETVTKKVLNE ETGVEEEVSE EVTKTIKKKV SKEVEVDDNA LFGLLNAPEK FAETLEKYLA       540
     KKEKFALMVG PDLYTHPNAA NCARLVALIE KYTPFSVTMI PNLANTLGAA LICDLDSSRG       600
     SYTIGYNTRG DFTLSALGNG DLDMPALNQQ EGTLTGIDKR VNPTNAALGY GGYVLNDIAN       660
     ALGITAKYTV DYTAQLPVKN GFKALSFDTL PNYYTNAGEE VRGYVLENIA VNSGGDESVQ       720
     PLNPNAAIRE NVVYLANPVL QFSAFTAASH QLNAKGGLYA SHTAMQTNGW SEGDALRVKT       780
     AHGELSVNVI ADGKIGGDIT YLPTFDTAIN SEALFDGYRF ACVSIQKV                    828
//

If you have problems or comments...

PBIL Back to PBIL home page