(data stored in ACNUC7421 zone)

EMBL: CP002355.PE271

CP002355.PE271       Location/Qualifiers
FT   CDS             262975..263964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sulku_0272"
FT                   /product="NADH dehydrogenase subunit H"
FT                   /EC_number="7.1.1.2"
FT                   /note="COGs: COG1005 NADH:ubiquinone oxidoreductase subunit
FT                   1 (chain H); InterPro IPR018086: IPR001694; KEGG:
FT                   tdn:Suden_1821 NADH dehydrogenase subunit H; PFAM:
FT                   respiratory-chain NADH dehydrogenase subunit 1; PRIAM: NADH
FT                   dehydrogenase (quinone); SPTR: NADH-quinone oxidoreductase
FT                   subunit h; PFAM: NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sulku_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADR32939"
FT                   /db_xref="GOA:E4TYG2"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:E4TYG2"
FT                   /protein_id="ADR32939.1"
FT                   /translation="MDVAFIIETIVKIVVILLIFSALAGLGTYFERKVLAFMQRRLGPM
FT                   HVGPFGLLQVAADGIKLFTKEDIIPQNVVKPIFKIAPVITAATAFMASAAIPFWPQFTV
FT                   FGYTVHPIVADINVGILYVLGVMAIGLYGPLLGGMASANKWSLISAARSAAIFISYEVI
FT                   SGLSLLAPLMMVGSLSLIDINNYQAGGIGNWIVWSQPVAFILFWIAAFAETGRTPFHLV
FT                   ANDHEIIDGFGTEYSGMRWGMFFIGEYANMFFISFVIAIIFLGGFGDGTIAGAIQLLLK
FT                   VAFFFFFFLWTRAAWPDIRPDQLMWLCWKVLMPIAVINIVVTGIVMMF"
     MDVAFIIETI VKIVVILLIF SALAGLGTYF ERKVLAFMQR RLGPMHVGPF GLLQVAADGI        60
     KLFTKEDIIP QNVVKPIFKI APVITAATAF MASAAIPFWP QFTVFGYTVH PIVADINVGI       120
     LYVLGVMAIG LYGPLLGGMA SANKWSLISA ARSAAIFISY EVISGLSLLA PLMMVGSLSL       180
     IDINNYQAGG IGNWIVWSQP VAFILFWIAA FAETGRTPFH LVANDHEIID GFGTEYSGMR       240
     WGMFFIGEYA NMFFISFVIA IIFLGGFGDG TIAGAIQLLL KVAFFFFFFL WTRAAWPDIR       300
     PDQLMWLCWK VLMPIAVINI VVTGIVMMF                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page